BLASTX nr result
ID: Ophiopogon27_contig00010796
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00010796 (456 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK81774.1| uncharacterized protein A4U43_C01F32740 [Asparagu... 62 2e-08 >gb|ONK81774.1| uncharacterized protein A4U43_C01F32740 [Asparagus officinalis] Length = 477 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/46 (54%), Positives = 34/46 (73%) Frame = -2 Query: 140 PILVRSCSTYNFSCGNFSIEIQYPFFSDQNHGCSGGLHYVQCLNLV 3 P+L SCS YNFSCGN+++ I+YPF+++ GLH VQC+NLV Sbjct: 13 PLLAHSCSLYNFSCGNYTLGIKYPFYTNTGPNQCDGLHLVQCMNLV 58