BLASTX nr result
ID: Ophiopogon27_contig00010105
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00010105 (374 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020106129.1| HD domain-containing protein 2 [Ananas comosus] 79 4e-15 gb|OAY82694.1| HD domain-containing protein 2 [Ananas comosus] 79 4e-15 ref|XP_008800883.1| PREDICTED: HD domain-containing protein 2 [P... 77 2e-14 ref|XP_020256761.1| HD domain-containing protein 2 [Asparagus of... 75 2e-14 gb|ONK81791.1| uncharacterized protein A4U43_C01F32910 [Asparagu... 75 5e-14 ref|XP_009409901.1| PREDICTED: HD domain-containing protein 2 is... 74 2e-13 ref|XP_010924220.1| PREDICTED: HD domain-containing protein 2 is... 74 2e-13 ref|XP_024194504.1| HD domain-containing protein C4G3.17 [Rosa c... 74 4e-13 ref|XP_004298319.2| PREDICTED: HD domain-containing protein C4G3... 74 4e-13 ref|XP_009356558.1| PREDICTED: HD domain-containing protein 2-li... 72 5e-13 ref|XP_021661553.1| HD domain-containing protein 2-like isoform ... 69 2e-12 ref|XP_021661550.1| HD domain-containing protein 2-like isoform ... 69 2e-12 ref|XP_009409902.1| PREDICTED: HD domain-containing protein 2 is... 70 4e-12 ref|XP_012855225.1| PREDICTED: HD domain-containing protein 2 [E... 71 4e-12 gb|OWM89405.1| hypothetical protein CDL15_Pgr024153 [Punica gran... 70 6e-12 ref|XP_009355886.1| PREDICTED: HD domain-containing protein C4G3... 70 6e-12 ref|XP_009409900.1| PREDICTED: HD domain-containing protein 2 is... 70 9e-12 ref|XP_004969283.1| HD domain-containing protein 2 homolog [Seta... 70 1e-11 ref|XP_002456036.1| HD domain-containing protein 2 homolog [Sorg... 70 1e-11 gb|PKA55555.1| hypothetical protein AXF42_Ash006757 [Apostasia s... 69 1e-11 >ref|XP_020106129.1| HD domain-containing protein 2 [Ananas comosus] Length = 262 Score = 79.0 bits (193), Expect = 4e-15 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = +1 Query: 4 HGKVLDEFFLSTAGKFQTDLGKKWAAEVIARRNKSLGKQS 123 HGKVLDEFFLSTAGKFQTDLGK+WAAEV+ARRNK LGKQ+ Sbjct: 223 HGKVLDEFFLSTAGKFQTDLGKRWAAEVVARRNKRLGKQA 262 >gb|OAY82694.1| HD domain-containing protein 2 [Ananas comosus] Length = 262 Score = 79.0 bits (193), Expect = 4e-15 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = +1 Query: 4 HGKVLDEFFLSTAGKFQTDLGKKWAAEVIARRNKSLGKQS 123 HGKVLDEFFLSTAGKFQTDLGK+WAAEV+ARRNK LGKQ+ Sbjct: 223 HGKVLDEFFLSTAGKFQTDLGKRWAAEVVARRNKRLGKQA 262 >ref|XP_008800883.1| PREDICTED: HD domain-containing protein 2 [Phoenix dactylifera] Length = 279 Score = 77.4 bits (189), Expect = 2e-14 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = +1 Query: 1 EHGKVLDEFFLSTAGKFQTDLGKKWAAEVIARRNKSLGKQS 123 EHGKVLDEFFLSTAGKFQTD+GK WAAEVI RRNK LGKQ+ Sbjct: 228 EHGKVLDEFFLSTAGKFQTDVGKSWAAEVILRRNKRLGKQA 268 >ref|XP_020256761.1| HD domain-containing protein 2 [Asparagus officinalis] Length = 150 Score = 74.7 bits (182), Expect = 2e-14 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +1 Query: 1 EHGKVLDEFFLSTAGKFQTDLGKKWAAEVIARRNKSLGKQS 123 +HGKVLDEFFLSTAGKFQTD+GK+WAAEV ARRNK LG Q+ Sbjct: 110 DHGKVLDEFFLSTAGKFQTDVGKRWAAEVTARRNKRLGHQA 150 >gb|ONK81791.1| uncharacterized protein A4U43_C01F32910 [Asparagus officinalis] Length = 190 Score = 74.7 bits (182), Expect = 5e-14 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +1 Query: 1 EHGKVLDEFFLSTAGKFQTDLGKKWAAEVIARRNKSLGKQS 123 +HGKVLDEFFLSTAGKFQTD+GK+WAAEV ARRNK LG Q+ Sbjct: 150 DHGKVLDEFFLSTAGKFQTDVGKRWAAEVTARRNKRLGHQA 190 >ref|XP_009409901.1| PREDICTED: HD domain-containing protein 2 isoform X2 [Musa acuminata subsp. malaccensis] Length = 254 Score = 74.3 bits (181), Expect = 2e-13 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +1 Query: 1 EHGKVLDEFFLSTAGKFQTDLGKKWAAEVIARRNKSLGK 117 EHGKVLDEFFLSTAGKFQTD+GK WAAEVI+RRNK LG+ Sbjct: 214 EHGKVLDEFFLSTAGKFQTDVGKSWAAEVISRRNKRLGE 252 >ref|XP_010924220.1| PREDICTED: HD domain-containing protein 2 isoform X2 [Elaeis guineensis] Length = 281 Score = 74.3 bits (181), Expect = 2e-13 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = +1 Query: 1 EHGKVLDEFFLSTAGKFQTDLGKKWAAEVIARRNKSLGKQS 123 EHGKVLDEFFLSTAGKFQTD+GK WAAEV RRNK LG+Q+ Sbjct: 230 EHGKVLDEFFLSTAGKFQTDVGKSWAAEVTLRRNKRLGRQA 270 >ref|XP_024194504.1| HD domain-containing protein C4G3.17 [Rosa chinensis] gb|PRQ40479.1| putative HD/PDEase domain-containing protein [Rosa chinensis] Length = 266 Score = 73.6 bits (179), Expect = 4e-13 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = +1 Query: 1 EHGKVLDEFFLSTAGKFQTDLGKKWAAEVIARRNKSLGK 117 EHGKVLDEFF+STAGKFQTDLGK WAAE+I+RRN LGK Sbjct: 225 EHGKVLDEFFISTAGKFQTDLGKSWAAEIISRRNTRLGK 263 >ref|XP_004298319.2| PREDICTED: HD domain-containing protein C4G3.17 [Fragaria vesca subsp. vesca] Length = 300 Score = 73.9 bits (180), Expect = 4e-13 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = +1 Query: 1 EHGKVLDEFFLSTAGKFQTDLGKKWAAEVIARRNKSLGK 117 EHGKVLDEFF+STAGKFQTDLGK WAAE+I+RRN LGK Sbjct: 259 EHGKVLDEFFISTAGKFQTDLGKSWAAEIISRRNTQLGK 297 >ref|XP_009356558.1| PREDICTED: HD domain-containing protein 2-like [Pyrus x bretschneideri] Length = 187 Score = 72.0 bits (175), Expect = 5e-13 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = +1 Query: 1 EHGKVLDEFFLSTAGKFQTDLGKKWAAEVIARRNKSLGK 117 EHGKVLDEFF+STAGKF+TDLGK WAAE+IARRN LG+ Sbjct: 136 EHGKVLDEFFISTAGKFRTDLGKSWAAEIIARRNSRLGQ 174 >ref|XP_021661553.1| HD domain-containing protein 2-like isoform X2 [Hevea brasiliensis] Length = 109 Score = 68.6 bits (166), Expect = 2e-12 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = +1 Query: 1 EHGKVLDEFFLSTAGKFQTDLGKKWAAEVIARRNKSLGKQ 120 EHGKVLDEFFLSTAGKFQT++GK WAAE+I+RRN L + Sbjct: 68 EHGKVLDEFFLSTAGKFQTEIGKSWAAEIISRRNSRLASK 107 >ref|XP_021661550.1| HD domain-containing protein 2-like isoform X1 [Hevea brasiliensis] ref|XP_021661551.1| HD domain-containing protein 2-like isoform X1 [Hevea brasiliensis] ref|XP_021661552.1| HD domain-containing protein 2-like isoform X1 [Hevea brasiliensis] Length = 113 Score = 68.6 bits (166), Expect = 2e-12 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = +1 Query: 1 EHGKVLDEFFLSTAGKFQTDLGKKWAAEVIARRNKSLGKQ 120 EHGKVLDEFFLSTAGKFQT++GK WAAE+I+RRN L + Sbjct: 72 EHGKVLDEFFLSTAGKFQTEIGKSWAAEIISRRNSRLASK 111 >ref|XP_009409902.1| PREDICTED: HD domain-containing protein 2 isoform X3 [Musa acuminata subsp. malaccensis] Length = 235 Score = 70.5 bits (171), Expect = 4e-12 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +1 Query: 1 EHGKVLDEFFLSTAGKFQTDLGKKWAAEVIARRNK 105 EHGKVLDEFFLSTAGKFQTD+GK WAAEVI+RRNK Sbjct: 133 EHGKVLDEFFLSTAGKFQTDVGKSWAAEVISRRNK 167 >ref|XP_012855225.1| PREDICTED: HD domain-containing protein 2 [Erythranthe guttata] gb|EYU22602.1| hypothetical protein MIMGU_mgv1a011893mg [Erythranthe guttata] Length = 267 Score = 70.9 bits (172), Expect = 4e-12 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +1 Query: 1 EHGKVLDEFFLSTAGKFQTDLGKKWAAEVIARRNKSLGKQS 123 EHGKVLDEFFLSTAGKFQT+ GKKWAAE+I+RRN L +S Sbjct: 226 EHGKVLDEFFLSTAGKFQTETGKKWAAEIISRRNSRLANRS 266 >gb|OWM89405.1| hypothetical protein CDL15_Pgr024153 [Punica granatum] gb|PKI40392.1| hypothetical protein CRG98_039238 [Punica granatum] Length = 266 Score = 70.5 bits (171), Expect = 6e-12 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = +1 Query: 1 EHGKVLDEFFLSTAGKFQTDLGKKWAAEVIARRNKSLGK 117 EHGKVLDEFFLSTAGKFQT+LGK WAAE+I+RRN L K Sbjct: 225 EHGKVLDEFFLSTAGKFQTELGKSWAAEIISRRNARLAK 263 >ref|XP_009355886.1| PREDICTED: HD domain-containing protein C4G3.17 [Pyrus x bretschneideri] Length = 266 Score = 70.5 bits (171), Expect = 6e-12 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +1 Query: 1 EHGKVLDEFFLSTAGKFQTDLGKKWAAEVIARRNKSLG 114 EHGKVLDEFF+STAGKFQT+LG+ WAAE+IARRN LG Sbjct: 225 EHGKVLDEFFISTAGKFQTELGRSWAAEIIARRNSRLG 262 >ref|XP_009409900.1| PREDICTED: HD domain-containing protein 2 isoform X1 [Musa acuminata subsp. malaccensis] Length = 316 Score = 70.5 bits (171), Expect = 9e-12 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +1 Query: 1 EHGKVLDEFFLSTAGKFQTDLGKKWAAEVIARRNK 105 EHGKVLDEFFLSTAGKFQTD+GK WAAEVI+RRNK Sbjct: 214 EHGKVLDEFFLSTAGKFQTDVGKSWAAEVISRRNK 248 >ref|XP_004969283.1| HD domain-containing protein 2 homolog [Setaria italica] gb|KQL06058.1| hypothetical protein SETIT_002610mg [Setaria italica] Length = 259 Score = 69.7 bits (169), Expect = 1e-11 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +1 Query: 1 EHGKVLDEFFLSTAGKFQTDLGKKWAAEVIARRNKSLGKQ 120 EHGKVLDEFFLSTAGKFQT++GK WAAEV ARR + GKQ Sbjct: 219 EHGKVLDEFFLSTAGKFQTEIGKSWAAEVNARRKEGCGKQ 258 >ref|XP_002456036.1| HD domain-containing protein 2 homolog [Sorghum bicolor] gb|EES01156.1| hypothetical protein SORBI_3003G235100 [Sorghum bicolor] Length = 259 Score = 69.7 bits (169), Expect = 1e-11 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +1 Query: 1 EHGKVLDEFFLSTAGKFQTDLGKKWAAEVIARRNKSLGKQ 120 EHGKVLDEFFLSTAGKFQT++GK WAAEV ARR + GKQ Sbjct: 219 EHGKVLDEFFLSTAGKFQTEIGKSWAAEVNARRKEGCGKQ 258 >gb|PKA55555.1| hypothetical protein AXF42_Ash006757 [Apostasia shenzhenica] Length = 250 Score = 69.3 bits (168), Expect = 1e-11 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = +1 Query: 1 EHGKVLDEFFLSTAGKFQTDLGKKWAAEVIARRNKSLGK 117 EH KVLDEFF+STAGKFQTD+GK+WAAEV +RRNK LG+ Sbjct: 209 EHEKVLDEFFISTAGKFQTDVGKRWAAEVTSRRNKRLGE 247