BLASTX nr result
ID: Ophiopogon27_contig00009911
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00009911 (514 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020266597.1| mediator of RNA polymerase II transcription ... 54 3e-06 >ref|XP_020266597.1| mediator of RNA polymerase II transcription subunit 22b-like [Asparagus officinalis] Length = 131 Score = 54.3 bits (129), Expect = 3e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +2 Query: 2 LLERIGEQASASLKELETHYYSSVMRMGQSEE 97 +LERIGEQA+ASLKELE+HYYSSVMR Q+EE Sbjct: 100 MLERIGEQAAASLKELESHYYSSVMRTVQNEE 131