BLASTX nr result
ID: Ophiopogon27_contig00009510
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00009510 (603 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_015868829.1| PREDICTED: uncharacterized protein LOC107406... 75 1e-14 ref|XP_015570959.1| PREDICTED: uncharacterized protein LOC107260... 74 2e-14 ref|XP_011047973.1| PREDICTED: uncharacterized protein LOC105142... 74 2e-14 gb|KRH51498.1| hypothetical protein GLYMA_06G010300 [Glycine max] 73 4e-14 ref|XP_011037477.1| PREDICTED: uncharacterized protein LOC105134... 73 6e-14 ref|XP_012436849.1| PREDICTED: uncharacterized protein LOC105763... 72 8e-14 ref|XP_016696981.1| PREDICTED: uncharacterized protein LOC107913... 72 2e-13 ref|XP_010233766.1| PREDICTED: uncharacterized protein LOC104583... 72 2e-13 gb|PNT36305.1| hypothetical protein POPTR_005G119400v3 [Populus ... 72 2e-13 ref|XP_015576248.1| PREDICTED: uncharacterized protein LOC107261... 71 2e-13 ref|XP_016682625.1| PREDICTED: uncharacterized protein LOC107901... 71 3e-13 gb|OAY57449.1| hypothetical protein MANES_02G097800 [Manihot esc... 70 5e-13 gb|PIA52775.1| hypothetical protein AQUCO_01000560v1 [Aquilegia ... 70 7e-13 ref|XP_008241732.2| PREDICTED: uncharacterized protein LOC103340... 70 7e-13 ref|XP_016497894.1| PREDICTED: uncharacterized protein LOC107816... 70 9e-13 ref|XP_006362036.1| PREDICTED: uncharacterized protein LOC102590... 70 9e-13 gb|OAY52326.1| hypothetical protein MANES_04G074200 [Manihot esc... 69 1e-12 ref|XP_011028507.1| PREDICTED: uncharacterized protein LOC105128... 69 1e-12 ref|XP_008784952.1| PREDICTED: uncharacterized protein LOC103703... 69 1e-12 gb|OAY37235.1| hypothetical protein MANES_11G084900 [Manihot esc... 69 3e-12 >ref|XP_015868829.1| PREDICTED: uncharacterized protein LOC107406238 [Ziziphus jujuba] Length = 41 Score = 74.7 bits (182), Expect = 1e-14 Identities = 37/42 (88%), Positives = 38/42 (90%) Frame = -2 Query: 137 MSPILSELFLSGCMINSTFRRRRTHLVQSFSVVFLYWFYVFS 12 MSPILSE+FLSGCMINSTF RRRTHLVQSFSVVFLYW Y S Sbjct: 1 MSPILSEIFLSGCMINSTF-RRRTHLVQSFSVVFLYWLYYVS 41 >ref|XP_015570959.1| PREDICTED: uncharacterized protein LOC107260797 [Ricinus communis] Length = 41 Score = 73.9 bits (180), Expect = 2e-14 Identities = 37/42 (88%), Positives = 37/42 (88%) Frame = -2 Query: 137 MSPILSELFLSGCMINSTFRRRRTHLVQSFSVVFLYWFYVFS 12 MSPILSELF SGCMINSTF RRRTHLVQSFSVVFLYW Y S Sbjct: 1 MSPILSELFFSGCMINSTF-RRRTHLVQSFSVVFLYWLYYVS 41 >ref|XP_011047973.1| PREDICTED: uncharacterized protein LOC105142160 [Populus euphratica] Length = 41 Score = 73.9 bits (180), Expect = 2e-14 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = -2 Query: 137 MSPILSELFLSGCMINSTFRRRRTHLVQSFSVVFLYWFYVFS 12 MSPILSE+F+SGCMINSTF RRRTHLVQSFSVVFLYW Y S Sbjct: 1 MSPILSEIFISGCMINSTF-RRRTHLVQSFSVVFLYWLYYVS 41 >gb|KRH51498.1| hypothetical protein GLYMA_06G010300 [Glycine max] Length = 42 Score = 73.2 bits (178), Expect = 4e-14 Identities = 34/42 (80%), Positives = 35/42 (83%) Frame = -2 Query: 137 MSPILSELFLSGCMINSTFRRRRTHLVQSFSVVFLYWFYVFS 12 M PILSE+F SGCMINST RRRRTHLVQSFSV FLYW Y S Sbjct: 1 MYPILSEIFFSGCMINSTVRRRRTHLVQSFSVAFLYWLYYVS 42 >ref|XP_011037477.1| PREDICTED: uncharacterized protein LOC105134676 [Populus euphratica] Length = 41 Score = 72.8 bits (177), Expect = 6e-14 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = -2 Query: 137 MSPILSELFLSGCMINSTFRRRRTHLVQSFSVVFLYWFYVFS 12 MSPILSE+F++GCMINSTF RRRTHLVQSFSVVFLYW Y S Sbjct: 1 MSPILSEIFITGCMINSTF-RRRTHLVQSFSVVFLYWLYYVS 41 >ref|XP_012436849.1| PREDICTED: uncharacterized protein LOC105763252 [Gossypium raimondii] ref|XP_016723474.1| PREDICTED: uncharacterized protein LOC107935386 [Gossypium hirsutum] ref|XP_016735458.1| PREDICTED: uncharacterized protein LOC107945825 [Gossypium hirsutum] ref|XP_017637265.1| PREDICTED: uncharacterized protein LOC108479277 [Gossypium arboreum] ref|XP_017970110.1| PREDICTED: uncharacterized protein LOC108660570 [Theobroma cacao] Length = 41 Score = 72.4 bits (176), Expect = 8e-14 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = -2 Query: 137 MSPILSELFLSGCMINSTFRRRRTHLVQSFSVVFLYWFYVFS 12 MSP+LSE+ LSG MINST RRR THLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLSEILLSGFMINSTLRRR-THLVQSFSVVFLYWFYVFS 41 >ref|XP_016696981.1| PREDICTED: uncharacterized protein LOC107913053 [Gossypium hirsutum] Length = 41 Score = 71.6 bits (174), Expect = 2e-13 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = -2 Query: 137 MSPILSELFLSGCMINSTFRRRRTHLVQSFSVVFLYWFYVFS 12 MSP++SE+ LSG MINST RRR THLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVVSEILLSGLMINSTLRRR-THLVQSFSVVFLYWFYVFS 41 >ref|XP_010233766.1| PREDICTED: uncharacterized protein LOC104583416 [Brachypodium distachyon] ref|XP_015622691.1| PREDICTED: uncharacterized protein LOC107279891 [Oryza sativa Japonica Group] ref|XP_015890019.1| PREDICTED: uncharacterized protein LOC107424684 [Ziziphus jujuba] gb|KQJ93156.1| hypothetical protein BRADI_3g02990v3 [Brachypodium distachyon] gb|KXG29403.1| hypothetical protein SORBI_3004G031200 [Sorghum bicolor] gb|OEL36113.1| hypothetical protein BAE44_0002863 [Dichanthelium oligosanthes] gb|PAN03873.1| hypothetical protein PAHAL_A00206 [Panicum hallii] Length = 41 Score = 71.6 bits (174), Expect = 2e-13 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = -2 Query: 137 MSPILSELFLSGCMINSTFRRRRTHLVQSFSVVFLYWFYVFS 12 MSP++SE+ LSG MINST RRR THLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVISEILLSGFMINSTLRRR-THLVQSFSVVFLYWFYVFS 41 >gb|PNT36305.1| hypothetical protein POPTR_005G119400v3 [Populus trichocarpa] Length = 42 Score = 71.6 bits (174), Expect = 2e-13 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = -2 Query: 137 MSPILSELFLSGCMINSTFRRRRTHLVQSFSVVFLYWFYVFS 12 M+P+L E+ LSG MINST RRR THLVQSFSVVFLYWFYVFS Sbjct: 1 MTPVLCEILLSGFMINSTRRRRITHLVQSFSVVFLYWFYVFS 42 >ref|XP_015576248.1| PREDICTED: uncharacterized protein LOC107261451 [Ricinus communis] Length = 41 Score = 71.2 bits (173), Expect = 2e-13 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = -2 Query: 137 MSPILSELFLSGCMINSTFRRRRTHLVQSFSVVFLYWFYVFS 12 MSP++SE+ LSG MINST RRR THLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVVSEILLSGFMINSTLRRR-THLVQSFSVVFLYWFYVFS 41 >ref|XP_016682625.1| PREDICTED: uncharacterized protein LOC107901221 [Gossypium hirsutum] ref|XP_017629680.1| PREDICTED: uncharacterized protein LOC108472643 [Gossypium arboreum] Length = 41 Score = 70.9 bits (172), Expect = 3e-13 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = -2 Query: 137 MSPILSELFLSGCMINSTFRRRRTHLVQSFSVVFLYWFYVFS 12 MSP+L E+ LSG MINST RRR THLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLCEILLSGLMINSTLRRR-THLVQSFSVVFLYWFYVFS 41 >gb|OAY57449.1| hypothetical protein MANES_02G097800 [Manihot esculenta] Length = 41 Score = 70.5 bits (171), Expect = 5e-13 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = -2 Query: 137 MSPILSELFLSGCMINSTFRRRRTHLVQSFSVVFLYWFYVFS 12 MSP+L E+ LSG MINST RRR THLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLCEILLSGFMINSTLRRR-THLVQSFSVVFLYWFYVFS 41 >gb|PIA52775.1| hypothetical protein AQUCO_01000560v1 [Aquilegia coerulea] Length = 41 Score = 70.1 bits (170), Expect = 7e-13 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = -2 Query: 137 MSPILSELFLSGCMINSTFRRRRTHLVQSFSVVFLYWFYVFS 12 MSP+LSE+ L G MINST RRR THLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLSEILLLGFMINSTLRRR-THLVQSFSVVFLYWFYVFS 41 >ref|XP_008241732.2| PREDICTED: uncharacterized protein LOC103340134 [Prunus mume] gb|ONH96935.1| hypothetical protein PRUPE_7G160500 [Prunus persica] Length = 41 Score = 70.1 bits (170), Expect = 7e-13 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = -2 Query: 137 MSPILSELFLSGCMINSTFRRRRTHLVQSFSVVFLYWFYVFS 12 MSP+LSE+ LSG M+NST RRR THLVQSFSV FLYWFYVFS Sbjct: 1 MSPVLSEILLSGFMVNSTLRRR-THLVQSFSVCFLYWFYVFS 41 >ref|XP_016497894.1| PREDICTED: uncharacterized protein LOC107816674 [Nicotiana tabacum] gb|PIN15171.1| hypothetical protein CDL12_12183 [Handroanthus impetiginosus] Length = 41 Score = 69.7 bits (169), Expect = 9e-13 Identities = 36/42 (85%), Positives = 37/42 (88%) Frame = -2 Query: 137 MSPILSELFLSGCMINSTFRRRRTHLVQSFSVVFLYWFYVFS 12 MS ILSELFLSG MINST+RRR THLVQSFSVVFLYWFY S Sbjct: 1 MSAILSELFLSGFMINSTYRRR-THLVQSFSVVFLYWFYYIS 41 >ref|XP_006362036.1| PREDICTED: uncharacterized protein LOC102590957 [Solanum tuberosum] ref|XP_015058155.1| PREDICTED: uncharacterized protein LOC107004438 [Solanum pennellii] ref|XP_016539774.1| PREDICTED: uncharacterized protein LOC107840430 [Capsicum annuum] gb|PHT59094.1| hypothetical protein CQW23_01457 [Capsicum baccatum] gb|PHT61932.1| hypothetical protein T459_34201 [Capsicum annuum] gb|PHU10636.1| hypothetical protein BC332_22496 [Capsicum chinense] Length = 41 Score = 69.7 bits (169), Expect = 9e-13 Identities = 36/42 (85%), Positives = 37/42 (88%) Frame = -2 Query: 137 MSPILSELFLSGCMINSTFRRRRTHLVQSFSVVFLYWFYVFS 12 MS ILSELFLSG MINST+RRR THLVQSFSVVFLYWFY S Sbjct: 1 MSAILSELFLSGFMINSTYRRR-THLVQSFSVVFLYWFYFIS 41 >gb|OAY52326.1| hypothetical protein MANES_04G074200 [Manihot esculenta] Length = 41 Score = 69.3 bits (168), Expect = 1e-12 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = -2 Query: 137 MSPILSELFLSGCMINSTFRRRRTHLVQSFSVVFLYWFYVFS 12 MSPILSE+FLSG MINST+RRR THLVQSFSVVFLYW Y S Sbjct: 1 MSPILSEIFLSGFMINSTYRRR-THLVQSFSVVFLYWLYYVS 41 >ref|XP_011028507.1| PREDICTED: uncharacterized protein LOC105128494 [Populus euphratica] Length = 41 Score = 69.3 bits (168), Expect = 1e-12 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = -2 Query: 137 MSPILSELFLSGCMINSTFRRRRTHLVQSFSVVFLYWFYVFS 12 M+P+L E+ LSG MINST RRR THLVQSFSVVFLYWFYVFS Sbjct: 1 MTPVLCEILLSGFMINSTLRRR-THLVQSFSVVFLYWFYVFS 41 >ref|XP_008784952.1| PREDICTED: uncharacterized protein LOC103703760 [Phoenix dactylifera] ref|XP_008795970.1| PREDICTED: uncharacterized protein LOC103711555 [Phoenix dactylifera] Length = 41 Score = 69.3 bits (168), Expect = 1e-12 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = -2 Query: 137 MSPILSELFLSGCMINSTFRRRRTHLVQSFSVVFLYWFYVFS 12 MSPILSE+ LSG MI+S+ RRR THLVQSFSVVFLYWFYVFS Sbjct: 1 MSPILSEILLSGFMISSSLRRR-THLVQSFSVVFLYWFYVFS 41 >gb|OAY37235.1| hypothetical protein MANES_11G084900 [Manihot esculenta] Length = 41 Score = 68.6 bits (166), Expect = 3e-12 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = -2 Query: 137 MSPILSELFLSGCMINSTFRRRRTHLVQSFSVVFLYWFYVFS 12 MSPI+SE+FLSG MINST+RRR THLVQSFSVVFLYW Y S Sbjct: 1 MSPIISEIFLSGFMINSTYRRR-THLVQSFSVVFLYWLYYVS 41