BLASTX nr result
ID: Ophiopogon27_contig00009358
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00009358 (489 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020256089.1| folate-biopterin transporter 1, chloroplasti... 55 7e-06 gb|ONK74330.1| uncharacterized protein A4U43_C03F5130 [Asparagus... 55 7e-06 >ref|XP_020256089.1| folate-biopterin transporter 1, chloroplastic [Asparagus officinalis] Length = 443 Score = 55.5 bits (132), Expect = 7e-06 Identities = 36/72 (50%), Positives = 37/72 (51%) Frame = -1 Query: 489 LMSISNXXXXXXXXXXXXXXXXXXXTKDSFSNLALLITICNXXXXXXXXXXXXXPREVPD 310 LMSISN TKDSFSNLALLITICN PR+ D Sbjct: 372 LMSISNGGSVSGGLFGAGLTQLLGVTKDSFSNLALLITICNLSSLLPLPLLGLLPRDAAD 431 Query: 309 TKNMDSEQTKLS 274 TKNMDSE TKLS Sbjct: 432 TKNMDSELTKLS 443 >gb|ONK74330.1| uncharacterized protein A4U43_C03F5130 [Asparagus officinalis] Length = 501 Score = 55.5 bits (132), Expect = 7e-06 Identities = 36/72 (50%), Positives = 37/72 (51%) Frame = -1 Query: 489 LMSISNXXXXXXXXXXXXXXXXXXXTKDSFSNLALLITICNXXXXXXXXXXXXXPREVPD 310 LMSISN TKDSFSNLALLITICN PR+ D Sbjct: 430 LMSISNGGSVSGGLFGAGLTQLLGVTKDSFSNLALLITICNLSSLLPLPLLGLLPRDAAD 489 Query: 309 TKNMDSEQTKLS 274 TKNMDSE TKLS Sbjct: 490 TKNMDSELTKLS 501