BLASTX nr result
ID: Ophiopogon27_contig00009315
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00009315 (540 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020241412.1| ACT domain-containing protein ACR9-like [Asp... 94 1e-19 ref|XP_020272729.1| ACT domain-containing protein ACR9-like [Asp... 94 2e-19 gb|ONK61449.1| uncharacterized protein A4U43_C08F30030 [Asparagu... 94 3e-19 gb|ONK65338.1| uncharacterized protein A4U43_C07F36090 [Asparagu... 94 3e-19 ref|XP_008784502.1| PREDICTED: ACT domain-containing protein ACR... 91 7e-19 ref|XP_010920651.1| PREDICTED: ACT domain-containing protein ACR... 90 7e-18 ref|XP_019706519.1| PREDICTED: ACT domain-containing protein ACR... 90 8e-18 gb|OVA18317.1| ACT domain [Macleaya cordata] 87 7e-17 ref|XP_010253240.1| PREDICTED: ACT domain-containing protein ACR... 86 2e-16 ref|XP_010253239.1| PREDICTED: ACT domain-containing protein ACR... 86 3e-16 ref|XP_019099780.1| PREDICTED: ACT domain-containing protein ACR... 81 7e-16 ref|XP_022764539.1| ACT domain-containing protein ACR9-like [Dur... 84 9e-16 dbj|GAV76086.1| ACT domain-containing protein [Cephalotus follic... 84 1e-15 gb|KZM97447.1| hypothetical protein DCAR_015191 [Daucus carota s... 83 1e-15 gb|PIA53053.1| hypothetical protein AQUCO_01000726v1 [Aquilegia ... 84 2e-15 ref|XP_006411185.1| ACT domain-containing protein ACR9 [Eutrema ... 83 3e-15 ref|XP_017247939.1| PREDICTED: ACT domain-containing protein ACR... 83 3e-15 ref|XP_021295267.1| ACT domain-containing protein ACR9 [Herrania... 83 3e-15 gb|OAY72183.1| ACT domain-containing protein ACR9 [Ananas comosus] 83 3e-15 gb|PKA56383.1| hypothetical protein AXF42_Ash014886 [Apostasia s... 82 3e-15 >ref|XP_020241412.1| ACT domain-containing protein ACR9-like [Asparagus officinalis] Length = 344 Score = 94.0 bits (232), Expect = 1e-19 Identities = 42/48 (87%), Positives = 47/48 (97%) Frame = -2 Query: 536 AEIGRHTASDRQWEVYRFLLEETREYPLANKRARSQIVDRVRRTLMGW 393 AEIGRHT ++RQWEVYRFLLEETREYPLANK+ARS+I+DRVRRTLMGW Sbjct: 297 AEIGRHTTAERQWEVYRFLLEETREYPLANKQARSKIIDRVRRTLMGW 344 >ref|XP_020272729.1| ACT domain-containing protein ACR9-like [Asparagus officinalis] Length = 439 Score = 94.4 bits (233), Expect = 2e-19 Identities = 43/48 (89%), Positives = 46/48 (95%) Frame = -2 Query: 536 AEIGRHTASDRQWEVYRFLLEETREYPLANKRARSQIVDRVRRTLMGW 393 AEIGRHT S+RQWEVYRFLLEETREYPLAN++AR QIVDRVRRTLMGW Sbjct: 392 AEIGRHTTSERQWEVYRFLLEETREYPLANRQARDQIVDRVRRTLMGW 439 >gb|ONK61449.1| uncharacterized protein A4U43_C08F30030 [Asparagus officinalis] Length = 400 Score = 94.0 bits (232), Expect = 3e-19 Identities = 42/48 (87%), Positives = 47/48 (97%) Frame = -2 Query: 536 AEIGRHTASDRQWEVYRFLLEETREYPLANKRARSQIVDRVRRTLMGW 393 AEIGRHT ++RQWEVYRFLLEETREYPLANK+ARS+I+DRVRRTLMGW Sbjct: 353 AEIGRHTTAERQWEVYRFLLEETREYPLANKQARSKIIDRVRRTLMGW 400 >gb|ONK65338.1| uncharacterized protein A4U43_C07F36090 [Asparagus officinalis] Length = 465 Score = 94.4 bits (233), Expect = 3e-19 Identities = 43/48 (89%), Positives = 46/48 (95%) Frame = -2 Query: 536 AEIGRHTASDRQWEVYRFLLEETREYPLANKRARSQIVDRVRRTLMGW 393 AEIGRHT S+RQWEVYRFLLEETREYPLAN++AR QIVDRVRRTLMGW Sbjct: 418 AEIGRHTTSERQWEVYRFLLEETREYPLANRQARDQIVDRVRRTLMGW 465 >ref|XP_008784502.1| PREDICTED: ACT domain-containing protein ACR9-like [Phoenix dactylifera] Length = 267 Score = 90.9 bits (224), Expect = 7e-19 Identities = 42/48 (87%), Positives = 45/48 (93%) Frame = -2 Query: 536 AEIGRHTASDRQWEVYRFLLEETREYPLANKRARSQIVDRVRRTLMGW 393 AEI RHT SDRQWEVYRFLL+ETR++PLAN RARSQIVDRVRRTLMGW Sbjct: 220 AEICRHTTSDRQWEVYRFLLDETRQFPLANSRARSQIVDRVRRTLMGW 267 >ref|XP_010920651.1| PREDICTED: ACT domain-containing protein ACR9 isoform X2 [Elaeis guineensis] Length = 416 Score = 90.1 bits (222), Expect = 7e-18 Identities = 42/48 (87%), Positives = 44/48 (91%) Frame = -2 Query: 536 AEIGRHTASDRQWEVYRFLLEETREYPLANKRARSQIVDRVRRTLMGW 393 AEI RHT SDRQWEVYRFLL+ETR +PLAN RARSQIVDRVRRTLMGW Sbjct: 369 AEICRHTTSDRQWEVYRFLLDETRRFPLANSRARSQIVDRVRRTLMGW 416 >ref|XP_019706519.1| PREDICTED: ACT domain-containing protein ACR9 isoform X1 [Elaeis guineensis] Length = 448 Score = 90.1 bits (222), Expect = 8e-18 Identities = 42/48 (87%), Positives = 44/48 (91%) Frame = -2 Query: 536 AEIGRHTASDRQWEVYRFLLEETREYPLANKRARSQIVDRVRRTLMGW 393 AEI RHT SDRQWEVYRFLL+ETR +PLAN RARSQIVDRVRRTLMGW Sbjct: 401 AEICRHTTSDRQWEVYRFLLDETRRFPLANSRARSQIVDRVRRTLMGW 448 >gb|OVA18317.1| ACT domain [Macleaya cordata] Length = 421 Score = 87.4 bits (215), Expect = 7e-17 Identities = 39/48 (81%), Positives = 44/48 (91%) Frame = -2 Query: 536 AEIGRHTASDRQWEVYRFLLEETREYPLANKRARSQIVDRVRRTLMGW 393 AEIGRH SDRQWEVYRFLL+E+ E+PLAN RAR+QIVD+VRRTLMGW Sbjct: 374 AEIGRHLTSDRQWEVYRFLLDESHEFPLANSRARNQIVDKVRRTLMGW 421 >ref|XP_010253240.1| PREDICTED: ACT domain-containing protein ACR9-like isoform X2 [Nelumbo nucifera] Length = 374 Score = 85.5 bits (210), Expect = 2e-16 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = -2 Query: 536 AEIGRHTASDRQWEVYRFLLEETREYPLANKRARSQIVDRVRRTLMGW 393 AEIGR+ SDRQWEVYRFLLEE+ EYPLAN + R+QIVDRVRRTLMGW Sbjct: 327 AEIGRYYTSDRQWEVYRFLLEESHEYPLANNQTRTQIVDRVRRTLMGW 374 >ref|XP_010253239.1| PREDICTED: ACT domain-containing protein ACR9-like isoform X1 [Nelumbo nucifera] Length = 419 Score = 85.5 bits (210), Expect = 3e-16 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = -2 Query: 536 AEIGRHTASDRQWEVYRFLLEETREYPLANKRARSQIVDRVRRTLMGW 393 AEIGR+ SDRQWEVYRFLLEE+ EYPLAN + R+QIVDRVRRTLMGW Sbjct: 372 AEIGRYYTSDRQWEVYRFLLEESHEYPLANNQTRTQIVDRVRRTLMGW 419 >ref|XP_019099780.1| PREDICTED: ACT domain-containing protein ACR9-like [Camelina sativa] Length = 190 Score = 81.3 bits (199), Expect = 7e-16 Identities = 37/48 (77%), Positives = 43/48 (89%) Frame = -2 Query: 536 AEIGRHTASDRQWEVYRFLLEETREYPLANKRARSQIVDRVRRTLMGW 393 AEIGRH+ DRQWEVYRFLL+E+RE PLA+ RAR+QIVDRV +TLMGW Sbjct: 143 AEIGRHSTLDRQWEVYRFLLDESRELPLASLRARNQIVDRVTKTLMGW 190 >ref|XP_022764539.1| ACT domain-containing protein ACR9-like [Durio zibethinus] Length = 427 Score = 84.3 bits (207), Expect = 9e-16 Identities = 37/48 (77%), Positives = 45/48 (93%) Frame = -2 Query: 536 AEIGRHTASDRQWEVYRFLLEETREYPLANKRARSQIVDRVRRTLMGW 393 AEIGRH+ SDRQWEVYRFLL+++RE+PLA+ +AR+QIVDRVRR LMGW Sbjct: 380 AEIGRHSTSDRQWEVYRFLLDDSREFPLASSQARNQIVDRVRRILMGW 427 >dbj|GAV76086.1| ACT domain-containing protein [Cephalotus follicularis] Length = 461 Score = 84.0 bits (206), Expect = 1e-15 Identities = 37/48 (77%), Positives = 45/48 (93%) Frame = -2 Query: 536 AEIGRHTASDRQWEVYRFLLEETREYPLANKRARSQIVDRVRRTLMGW 393 AE+GRH+ SDRQWEVYRFLL+++ E+PLA+K ARSQIV+RVRRTLMGW Sbjct: 414 AEVGRHSTSDRQWEVYRFLLDDSLEFPLASKLARSQIVERVRRTLMGW 461 >gb|KZM97447.1| hypothetical protein DCAR_015191 [Daucus carota subsp. sativus] Length = 314 Score = 82.8 bits (203), Expect = 1e-15 Identities = 36/48 (75%), Positives = 44/48 (91%) Frame = -2 Query: 536 AEIGRHTASDRQWEVYRFLLEETREYPLANKRARSQIVDRVRRTLMGW 393 AEIGRH+ DRQWEVYRFLL ++RE+PLA+KRA+++I DRVRRTLMGW Sbjct: 267 AEIGRHSTEDRQWEVYRFLLIDSREFPLASKRAKNEIADRVRRTLMGW 314 >gb|PIA53053.1| hypothetical protein AQUCO_01000726v1 [Aquilegia coerulea] Length = 421 Score = 83.6 bits (205), Expect = 2e-15 Identities = 39/48 (81%), Positives = 41/48 (85%) Frame = -2 Query: 536 AEIGRHTASDRQWEVYRFLLEETREYPLANKRARSQIVDRVRRTLMGW 393 AEI RHT SDRQWEVYRF LEE+R +PL N RAR QIVDRVRRTLMGW Sbjct: 374 AEIWRHTTSDRQWEVYRFRLEESRAFPLDNSRARDQIVDRVRRTLMGW 421 >ref|XP_006411185.1| ACT domain-containing protein ACR9 [Eutrema salsugineum] gb|ESQ52638.1| hypothetical protein EUTSA_v10016727mg [Eutrema salsugineum] Length = 414 Score = 82.8 bits (203), Expect = 3e-15 Identities = 37/48 (77%), Positives = 44/48 (91%) Frame = -2 Query: 536 AEIGRHTASDRQWEVYRFLLEETREYPLANKRARSQIVDRVRRTLMGW 393 AEIGRH+ DRQWEVYRFLL+E+RE+PLA+ RAR+QIVDRV +TLMGW Sbjct: 367 AEIGRHSTLDRQWEVYRFLLDESREFPLASLRARNQIVDRVTKTLMGW 414 >ref|XP_017247939.1| PREDICTED: ACT domain-containing protein ACR9 [Daucus carota subsp. sativus] Length = 421 Score = 82.8 bits (203), Expect = 3e-15 Identities = 36/48 (75%), Positives = 44/48 (91%) Frame = -2 Query: 536 AEIGRHTASDRQWEVYRFLLEETREYPLANKRARSQIVDRVRRTLMGW 393 AEIGRH+ DRQWEVYRFLL ++RE+PLA+KRA+++I DRVRRTLMGW Sbjct: 374 AEIGRHSTEDRQWEVYRFLLIDSREFPLASKRAKNEIADRVRRTLMGW 421 >ref|XP_021295267.1| ACT domain-containing protein ACR9 [Herrania umbratica] Length = 429 Score = 82.8 bits (203), Expect = 3e-15 Identities = 37/48 (77%), Positives = 44/48 (91%) Frame = -2 Query: 536 AEIGRHTASDRQWEVYRFLLEETREYPLANKRARSQIVDRVRRTLMGW 393 AEIGRH+ SDRQWEVYRFLL+++ E+PLA+ RAR+QIVDRVRR LMGW Sbjct: 382 AEIGRHSTSDRQWEVYRFLLDDSCEFPLASSRARNQIVDRVRRILMGW 429 >gb|OAY72183.1| ACT domain-containing protein ACR9 [Ananas comosus] Length = 433 Score = 82.8 bits (203), Expect = 3e-15 Identities = 39/49 (79%), Positives = 44/49 (89%), Gaps = 1/49 (2%) Frame = -2 Query: 536 AEIGRHTASDRQWEVYRFLLEETREYPLANKRA-RSQIVDRVRRTLMGW 393 AEIGR TAS+RQWEVYRFLL+E+RE+PLAN R R Q+VDRVRRTLMGW Sbjct: 384 AEIGRQTASERQWEVYRFLLDESREFPLANSRGNRDQVVDRVRRTLMGW 432 >gb|PKA56383.1| hypothetical protein AXF42_Ash014886 [Apostasia shenzhenica] Length = 382 Score = 82.4 bits (202), Expect = 3e-15 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = -2 Query: 539 LAEIGRHTASDRQWEVYRFLLEETREYPLANKRARSQIVDRVRRTLMGW 393 LAEIG+HT ++ QWEVYRFLLEE E+PL+N+R R QIVD+VRRTLMGW Sbjct: 334 LAEIGKHTTAENQWEVYRFLLEERTEFPLSNRRTRIQIVDKVRRTLMGW 382