BLASTX nr result
ID: Ophiopogon27_contig00008934
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00008934 (439 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020271396.1| transcription termination factor MTERF4, chl... 116 1e-27 >ref|XP_020271396.1| transcription termination factor MTERF4, chloroplastic [Asparagus officinalis] gb|ONK62881.1| uncharacterized protein A4U43_C07F9100 [Asparagus officinalis] Length = 514 Score = 116 bits (291), Expect = 1e-27 Identities = 61/89 (68%), Positives = 68/89 (76%) Frame = +3 Query: 171 MKLIANPNNIPKPSILSSGCLTHQNPFAKILTFALNRNEFKLRTTPTRAHAASSTYTPMP 350 MKLI +P +PK S+LSSGCLTH+NPFAKILTF N E KL P RA+AA ST P Sbjct: 1 MKLITDPI-MPKTSVLSSGCLTHRNPFAKILTFTRNHGECKL---PARAYAAYSTSAPKR 56 Query: 351 AHSPIHGRRTQNPNAPPSLYSRPSLQQMK 437 A P+HGRRTQNPN+PPSLYSRPSL QMK Sbjct: 57 ASPPVHGRRTQNPNSPPSLYSRPSLLQMK 85