BLASTX nr result
ID: Ophiopogon27_contig00008833
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00008833 (449 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020252528.1| uncharacterized protein LOC109829869 [Aspara... 65 3e-09 ref|XP_020507781.1| cyclic nucleotide-gated cation channel beta-... 55 5e-06 >ref|XP_020252528.1| uncharacterized protein LOC109829869 [Asparagus officinalis] ref|XP_020252529.1| uncharacterized protein LOC109829869 [Asparagus officinalis] ref|XP_020252530.1| uncharacterized protein LOC109829869 [Asparagus officinalis] gb|ONK76932.1| uncharacterized protein A4U43_C02F1380 [Asparagus officinalis] Length = 729 Score = 64.7 bits (156), Expect = 3e-09 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = -3 Query: 447 GRNKFNCQLSPEQVKDLCKLFQSEGKTINKKRPNEVVRAETEPI 316 GRNKF+C+LS EQVK+LCKLF+S GK KR EV+RAE EPI Sbjct: 389 GRNKFSCELSVEQVKNLCKLFKSAGKISKSKRSREVIRAEPEPI 432 >ref|XP_020507781.1| cyclic nucleotide-gated cation channel beta-1-like [Labrus bergylta] Length = 219 Score = 54.7 bits (130), Expect = 5e-06 Identities = 33/89 (37%), Positives = 46/89 (51%) Frame = -3 Query: 267 EESDELVESEDGLDGEEETENAVFKSEEGDQDAKEDEKVVCMGTDVSEGEKVEDGAVMGT 88 EE+ E E E+G DG++E + VF SE+ + KE E+ G D GE+ E G G Sbjct: 129 EEAAEGEEGEEGEDGKDECDYLVFDSEKRGAETKEGEETGKEGGDREGGEETERGGSEGG 188 Query: 87 DAPGGEKAEEGAVIKAVKDLGKDENTPKK 1 GG+K EE + +D G+ E KK Sbjct: 189 HERGGDKGEEEKEREEEEDEGRGEREKKK 217