BLASTX nr result
ID: Ophiopogon27_contig00008595
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00008595 (397 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020267062.1| putative glucose-6-phosphate 1-epimerase [As... 67 2e-10 gb|ONK70562.1| uncharacterized protein A4U43_C05F34990 [Asparagu... 67 2e-10 ref|XP_015866042.1| PREDICTED: putative glucose-6-phosphate 1-ep... 59 2e-07 ref|XP_023891127.1| putative glucose-6-phosphate 1-epimerase [Qu... 59 2e-07 ref|XP_015958519.1| putative glucose-6-phosphate 1-epimerase [Ar... 58 3e-07 ref|XP_023537692.1| putative glucose-6-phosphate 1-epimerase [Cu... 58 3e-07 ref|XP_022969606.1| putative glucose-6-phosphate 1-epimerase [Cu... 58 3e-07 ref|XP_022938200.1| putative glucose-6-phosphate 1-epimerase iso... 58 3e-07 ref|XP_020582599.1| putative glucose-6-phosphate 1-epimerase, pa... 57 5e-07 ref|XP_020685623.1| putative glucose-6-phosphate 1-epimerase [De... 57 5e-07 gb|PKA50618.1| Putative glucose-6-phosphate 1-epimerase [Apostas... 57 1e-06 dbj|BAH92807.1| Os04g0603000, partial [Oryza sativa Japonica Group] 54 1e-06 ref|XP_019433568.1| PREDICTED: putative glucose-6-phosphate 1-ep... 57 1e-06 ref|XP_009347016.1| PREDICTED: putative glucose-6-phosphate 1-ep... 55 1e-06 gb|KJB21962.1| hypothetical protein B456_004G026900 [Gossypium r... 56 1e-06 gb|PIA40804.1| hypothetical protein AQUCO_02400106v1 [Aquilegia ... 56 1e-06 gb|KJB21963.1| hypothetical protein B456_004G026900 [Gossypium r... 56 2e-06 ref|XP_018805951.1| PREDICTED: putative glucose-6-phosphate 1-ep... 56 2e-06 gb|OVA00917.1| Aldose 1-/Glucose-6-phosphate 1-epimerase [Maclea... 56 2e-06 gb|OMO96678.1| Aldose 1-/Glucose-6-phosphate 1-epimerase [Corcho... 56 2e-06 >ref|XP_020267062.1| putative glucose-6-phosphate 1-epimerase [Asparagus officinalis] Length = 286 Score = 67.0 bits (162), Expect = 2e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 397 GEEWKGSQEFCAVPSSYCSGQLDPHRVLHG 308 GEEWKGSQEFCAVPSSYCSGQLDP +VLHG Sbjct: 257 GEEWKGSQEFCAVPSSYCSGQLDPQKVLHG 286 >gb|ONK70562.1| uncharacterized protein A4U43_C05F34990 [Asparagus officinalis] Length = 286 Score = 67.0 bits (162), Expect = 2e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 397 GEEWKGSQEFCAVPSSYCSGQLDPHRVLHG 308 GEEWKGSQEFCAVPSSYCSGQLDP +VLHG Sbjct: 257 GEEWKGSQEFCAVPSSYCSGQLDPQKVLHG 286 >ref|XP_015866042.1| PREDICTED: putative glucose-6-phosphate 1-epimerase [Ziziphus jujuba] Length = 316 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -1 Query: 397 GEEWKGSQEFCAVPSSYCSGQLDPHRVLHG 308 GEEWKG QE AVPSSYCSGQLDPH+VL G Sbjct: 286 GEEWKGRQELSAVPSSYCSGQLDPHKVLQG 315 >ref|XP_023891127.1| putative glucose-6-phosphate 1-epimerase [Quercus suber] ref|XP_023891128.1| putative glucose-6-phosphate 1-epimerase [Quercus suber] Length = 331 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -1 Query: 397 GEEWKGSQEFCAVPSSYCSGQLDPHRVLHG 308 GEEWKG QE AVPSSYCSGQLDP +VLHG Sbjct: 301 GEEWKGRQELSAVPSSYCSGQLDPQKVLHG 330 >ref|XP_015958519.1| putative glucose-6-phosphate 1-epimerase [Arachis duranensis] ref|XP_016197095.1| putative glucose-6-phosphate 1-epimerase [Arachis ipaensis] Length = 318 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 397 GEEWKGSQEFCAVPSSYCSGQLDPHRVL 314 GEEWKG QE CAVPSSYCSGQLDP RVL Sbjct: 288 GEEWKGRQELCAVPSSYCSGQLDPKRVL 315 >ref|XP_023537692.1| putative glucose-6-phosphate 1-epimerase [Cucurbita pepo subsp. pepo] Length = 323 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -1 Query: 397 GEEWKGSQEFCAVPSSYCSGQLDPHRVLHG 308 GEEW+G E AVPSSYCSGQLDPH+VLHG Sbjct: 293 GEEWRGRLELSAVPSSYCSGQLDPHKVLHG 322 >ref|XP_022969606.1| putative glucose-6-phosphate 1-epimerase [Cucurbita maxima] ref|XP_022969608.1| putative glucose-6-phosphate 1-epimerase [Cucurbita maxima] Length = 323 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -1 Query: 397 GEEWKGSQEFCAVPSSYCSGQLDPHRVLHG 308 GEEW+G E AVPSSYCSGQLDPH+VLHG Sbjct: 293 GEEWRGRLELSAVPSSYCSGQLDPHKVLHG 322 >ref|XP_022938200.1| putative glucose-6-phosphate 1-epimerase isoform X1 [Cucurbita moschata] ref|XP_022938202.1| putative glucose-6-phosphate 1-epimerase isoform X1 [Cucurbita moschata] Length = 323 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -1 Query: 397 GEEWKGSQEFCAVPSSYCSGQLDPHRVLHG 308 GEEW+G E AVPSSYCSGQLDPH+VLHG Sbjct: 293 GEEWRGRLELSAVPSSYCSGQLDPHKVLHG 322 >ref|XP_020582599.1| putative glucose-6-phosphate 1-epimerase, partial [Phalaenopsis equestris] Length = 290 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -1 Query: 397 GEEWKGSQEFCAVPSSYCSGQLDPHRVLHG 308 GEEWKG E AVPSSYCSGQLDP RVLHG Sbjct: 261 GEEWKGRLELSAVPSSYCSGQLDPQRVLHG 290 >ref|XP_020685623.1| putative glucose-6-phosphate 1-epimerase [Dendrobium catenatum] ref|XP_020685624.1| putative glucose-6-phosphate 1-epimerase [Dendrobium catenatum] gb|PKU72960.1| Putative glucose-6-phosphate 1-epimerase [Dendrobium catenatum] Length = 313 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -1 Query: 397 GEEWKGSQEFCAVPSSYCSGQLDPHRVLHG 308 GEEWKG E AVPSSYCSGQLDP RVLHG Sbjct: 284 GEEWKGRLELSAVPSSYCSGQLDPQRVLHG 313 >gb|PKA50618.1| Putative glucose-6-phosphate 1-epimerase [Apostasia shenzhenica] Length = 313 Score = 56.6 bits (135), Expect = 1e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -1 Query: 397 GEEWKGSQEFCAVPSSYCSGQLDPHRVLHG 308 GEEWKG QE AVPSSYCSGQLDP +VL+G Sbjct: 284 GEEWKGRQELSAVPSSYCSGQLDPQKVLYG 313 >dbj|BAH92807.1| Os04g0603000, partial [Oryza sativa Japonica Group] Length = 92 Score = 53.5 bits (127), Expect = 1e-06 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = -1 Query: 397 GEEWKGSQEFCAVPSSYCSGQLDPHRVLHG 308 GEEWKG + AVPSSYCSGQLDP++VL G Sbjct: 63 GEEWKGKMDLSAVPSSYCSGQLDPNKVLQG 92 >ref|XP_019433568.1| PREDICTED: putative glucose-6-phosphate 1-epimerase [Lupinus angustifolius] gb|OIV89678.1| hypothetical protein TanjilG_07754 [Lupinus angustifolius] Length = 334 Score = 56.6 bits (135), Expect = 1e-06 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -1 Query: 397 GEEWKGSQEFCAVPSSYCSGQLDPHRVLHG 308 GEEWKG EF AVPSSYCSGQLDP RVL G Sbjct: 304 GEEWKGRLEFSAVPSSYCSGQLDPQRVLQG 333 >ref|XP_009347016.1| PREDICTED: putative glucose-6-phosphate 1-epimerase, partial [Pyrus x bretschneideri] Length = 152 Score = 54.7 bits (130), Expect = 1e-06 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = -1 Query: 397 GEEWKGSQEFCAVPSSYCSGQLDPHRVLHG 308 GEEW+G QE AVPSSYCSGQLDP +VL G Sbjct: 122 GEEWRGRQELSAVPSSYCSGQLDPRKVLQG 151 >gb|KJB21962.1| hypothetical protein B456_004G026900 [Gossypium raimondii] Length = 233 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = -1 Query: 397 GEEWKGSQEFCAVPSSYCSGQLDPHRVLHG 308 GEEW+G QE AVPSSYCSGQLDP RVL G Sbjct: 203 GEEWRGRQELSAVPSSYCSGQLDPRRVLQG 232 >gb|PIA40804.1| hypothetical protein AQUCO_02400106v1 [Aquilegia coerulea] Length = 236 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = -1 Query: 397 GEEWKGSQEFCAVPSSYCSGQLDPHRVLHG 308 GEEW+G QE AVPSSYCSGQLDP RVL G Sbjct: 206 GEEWRGRQELSAVPSSYCSGQLDPQRVLQG 235 >gb|KJB21963.1| hypothetical protein B456_004G026900 [Gossypium raimondii] Length = 270 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = -1 Query: 397 GEEWKGSQEFCAVPSSYCSGQLDPHRVLHG 308 GEEW+G QE AVPSSYCSGQLDP RVL G Sbjct: 240 GEEWRGRQELSAVPSSYCSGQLDPRRVLQG 269 >ref|XP_018805951.1| PREDICTED: putative glucose-6-phosphate 1-epimerase isoform X2 [Juglans regia] Length = 287 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = -1 Query: 397 GEEWKGSQEFCAVPSSYCSGQLDPHRVLHG 308 GEEWKG QE AVPSSYCSGQLDP +VL G Sbjct: 257 GEEWKGRQELSAVPSSYCSGQLDPQKVLQG 286 >gb|OVA00917.1| Aldose 1-/Glucose-6-phosphate 1-epimerase [Macleaya cordata] Length = 290 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = -1 Query: 397 GEEWKGSQEFCAVPSSYCSGQLDPHRVLHG 308 GEEW+G QE AVPSSYCSGQLDP RVL G Sbjct: 260 GEEWRGRQELSAVPSSYCSGQLDPQRVLQG 289 >gb|OMO96678.1| Aldose 1-/Glucose-6-phosphate 1-epimerase [Corchorus capsularis] Length = 314 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = -1 Query: 397 GEEWKGSQEFCAVPSSYCSGQLDPHRVLHG 308 GEEW+G QE AVPSSYCSGQLDP RVL G Sbjct: 284 GEEWRGRQELSAVPSSYCSGQLDPQRVLQG 313