BLASTX nr result
ID: Ophiopogon27_contig00008467
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00008467 (432 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010933824.1| PREDICTED: alpha carbonic anhydrase 8 [Elaei... 55 2e-06 >ref|XP_010933824.1| PREDICTED: alpha carbonic anhydrase 8 [Elaeis guineensis] Length = 182 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/49 (51%), Positives = 35/49 (71%), Gaps = 5/49 (10%) Frame = -2 Query: 431 PPPP-----SKADVQKPKKGINERVDEYIRHTKGKIRSVSGVGRVPSTK 300 P PP + A +KPKK INE+V++YI+ TK ++RSVSG+GR P+ K Sbjct: 134 PAPPQGAAAAAAPTEKPKKNINEKVEDYIKRTKDRLRSVSGIGRTPTIK 182