BLASTX nr result
ID: Ophiopogon27_contig00008354
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00008354 (427 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020242084.1| proteasome-associated protein ECM29 homolog ... 73 3e-12 ref|XP_020242083.1| proteasome-associated protein ECM29 homolog ... 73 3e-12 ref|XP_020242082.1| proteasome-associated protein ECM29 homolog ... 73 3e-12 ref|XP_010922049.1| PREDICTED: proteasome-associated protein ECM... 66 1e-09 ref|XP_010922048.1| PREDICTED: proteasome-associated protein ECM... 66 1e-09 ref|XP_010922045.1| PREDICTED: proteasome-associated protein ECM... 66 1e-09 gb|OAY74829.1| Proteasome-associated protein ECM [Ananas comosus] 63 1e-08 ref|XP_020113730.1| proteasome-associated protein ECM29 homolog ... 59 2e-07 ref|XP_020113729.1| proteasome-associated protein ECM29 homolog ... 59 2e-07 ref|XP_020113728.1| proteasome-associated protein ECM29 homolog ... 59 2e-07 gb|PKA49156.1| hypothetical protein AXF42_Ash010841 [Apostasia s... 57 2e-06 ref|XP_009410433.1| PREDICTED: proteasome-associated protein ECM... 55 6e-06 gb|PKU70004.1| hypothetical protein MA16_Dca022135 [Dendrobium c... 55 8e-06 ref|XP_020682977.1| proteasome-associated protein ECM29 homolog ... 55 8e-06 >ref|XP_020242084.1| proteasome-associated protein ECM29 homolog isoform X3 [Asparagus officinalis] Length = 1637 Score = 73.2 bits (178), Expect = 3e-12 Identities = 33/43 (76%), Positives = 40/43 (93%) Frame = -2 Query: 426 RGIPAAERRNVEFQDELTHLCEVEKSEQAKTLLRKVIAILEEL 298 RGIP+ +R+N+EF DEL HLCEVEKSEQAKTLL+KV+A+LEEL Sbjct: 1585 RGIPSEQRKNIEFSDELIHLCEVEKSEQAKTLLQKVVALLEEL 1627 >ref|XP_020242083.1| proteasome-associated protein ECM29 homolog isoform X2 [Asparagus officinalis] Length = 1793 Score = 73.2 bits (178), Expect = 3e-12 Identities = 33/43 (76%), Positives = 40/43 (93%) Frame = -2 Query: 426 RGIPAAERRNVEFQDELTHLCEVEKSEQAKTLLRKVIAILEEL 298 RGIP+ +R+N+EF DEL HLCEVEKSEQAKTLL+KV+A+LEEL Sbjct: 1741 RGIPSEQRKNIEFSDELIHLCEVEKSEQAKTLLQKVVALLEEL 1783 >ref|XP_020242082.1| proteasome-associated protein ECM29 homolog isoform X1 [Asparagus officinalis] gb|ONK61486.1| uncharacterized protein A4U43_C08F30410 [Asparagus officinalis] Length = 1813 Score = 73.2 bits (178), Expect = 3e-12 Identities = 33/43 (76%), Positives = 40/43 (93%) Frame = -2 Query: 426 RGIPAAERRNVEFQDELTHLCEVEKSEQAKTLLRKVIAILEEL 298 RGIP+ +R+N+EF DEL HLCEVEKSEQAKTLL+KV+A+LEEL Sbjct: 1761 RGIPSEQRKNIEFSDELIHLCEVEKSEQAKTLLQKVVALLEEL 1803 >ref|XP_010922049.1| PREDICTED: proteasome-associated protein ECM29 homolog isoform X3 [Elaeis guineensis] Length = 1763 Score = 65.9 bits (159), Expect = 1e-09 Identities = 30/43 (69%), Positives = 37/43 (86%) Frame = -2 Query: 426 RGIPAAERRNVEFQDELTHLCEVEKSEQAKTLLRKVIAILEEL 298 R IP +R+++EF+DEL HLCEVEKSEQAKTLLRK +AI E+L Sbjct: 1713 REIPLTQRKHIEFKDELVHLCEVEKSEQAKTLLRKCLAIFEDL 1755 >ref|XP_010922048.1| PREDICTED: proteasome-associated protein ECM29 homolog isoform X2 [Elaeis guineensis] Length = 1814 Score = 65.9 bits (159), Expect = 1e-09 Identities = 30/43 (69%), Positives = 37/43 (86%) Frame = -2 Query: 426 RGIPAAERRNVEFQDELTHLCEVEKSEQAKTLLRKVIAILEEL 298 R IP +R+++EF+DEL HLCEVEKSEQAKTLLRK +AI E+L Sbjct: 1764 REIPLTQRKHIEFKDELVHLCEVEKSEQAKTLLRKCLAIFEDL 1806 >ref|XP_010922045.1| PREDICTED: proteasome-associated protein ECM29 homolog isoform X1 [Elaeis guineensis] Length = 1819 Score = 65.9 bits (159), Expect = 1e-09 Identities = 30/43 (69%), Positives = 37/43 (86%) Frame = -2 Query: 426 RGIPAAERRNVEFQDELTHLCEVEKSEQAKTLLRKVIAILEEL 298 R IP +R+++EF+DEL HLCEVEKSEQAKTLLRK +AI E+L Sbjct: 1769 REIPLTQRKHIEFKDELVHLCEVEKSEQAKTLLRKCLAIFEDL 1811 >gb|OAY74829.1| Proteasome-associated protein ECM [Ananas comosus] Length = 1818 Score = 62.8 bits (151), Expect = 1e-08 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = -2 Query: 426 RGIPAAERRNVEFQDELTHLCEVEKSEQAKTLLRKVIAILEELQ 295 R P R+N+EF+D LTHLC VEKSEQAKT+LRK AILEEL+ Sbjct: 1769 RDFPLEYRKNIEFKDALTHLCGVEKSEQAKTVLRKCTAILEELE 1812 >ref|XP_020113730.1| proteasome-associated protein ECM29 homolog isoform X3 [Ananas comosus] Length = 1581 Score = 59.3 bits (142), Expect = 2e-07 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = -2 Query: 426 RGIPAAERRNVEFQDELTHLCEVEKSEQAKTLLRKVIAILEELQ 295 R P R+N+EF+D L HLC VEKSEQAKT+LRK ILEEL+ Sbjct: 1532 RDFPLEYRKNIEFKDALAHLCGVEKSEQAKTVLRKCTTILEELE 1575 >ref|XP_020113729.1| proteasome-associated protein ECM29 homolog isoform X2 [Ananas comosus] Length = 1817 Score = 59.3 bits (142), Expect = 2e-07 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = -2 Query: 426 RGIPAAERRNVEFQDELTHLCEVEKSEQAKTLLRKVIAILEELQ 295 R P R+N+EF+D L HLC VEKSEQAKT+LRK ILEEL+ Sbjct: 1768 RDFPLEYRKNIEFKDALAHLCGVEKSEQAKTVLRKCTTILEELE 1811 >ref|XP_020113728.1| proteasome-associated protein ECM29 homolog isoform X1 [Ananas comosus] Length = 1818 Score = 59.3 bits (142), Expect = 2e-07 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = -2 Query: 426 RGIPAAERRNVEFQDELTHLCEVEKSEQAKTLLRKVIAILEELQ 295 R P R+N+EF+D L HLC VEKSEQAKT+LRK ILEEL+ Sbjct: 1769 RDFPLEYRKNIEFKDALAHLCGVEKSEQAKTVLRKCTTILEELE 1812 >gb|PKA49156.1| hypothetical protein AXF42_Ash010841 [Apostasia shenzhenica] Length = 1818 Score = 56.6 bits (135), Expect = 2e-06 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -2 Query: 426 RGIPAAERRNVEFQDELTHLCEVEKSEQAKTLLRKVIAILEEL 298 R IP +RR+VEF+DEL HL EVE+SEQAKT + IA+LEEL Sbjct: 1768 RRIPPDQRRHVEFKDELIHLSEVERSEQAKTSFTRSIAVLEEL 1810 >ref|XP_009410433.1| PREDICTED: proteasome-associated protein ECM29 homolog [Musa acuminata subsp. malaccensis] Length = 1816 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 399 NVEFQDELTHLCEVEKSEQAKTLLRKVIAILEELQ 295 +VE +DEL HLCEVEKSEQAKTLLR+ I ILE+L+ Sbjct: 1772 DVELKDELVHLCEVEKSEQAKTLLRQCITILEDLK 1806 >gb|PKU70004.1| hypothetical protein MA16_Dca022135 [Dendrobium catenatum] Length = 1448 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/44 (56%), Positives = 35/44 (79%) Frame = -2 Query: 426 RGIPAAERRNVEFQDELTHLCEVEKSEQAKTLLRKVIAILEELQ 295 R IP+ ++R VEF+ E+ HL E+EKSEQAKT LR+ I IL++L+ Sbjct: 1398 RSIPSEQKRLVEFKSEVIHLMEIEKSEQAKTFLRRSIEILQDLE 1441 >ref|XP_020682977.1| proteasome-associated protein ECM29 homolog [Dendrobium catenatum] Length = 1812 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/44 (56%), Positives = 35/44 (79%) Frame = -2 Query: 426 RGIPAAERRNVEFQDELTHLCEVEKSEQAKTLLRKVIAILEELQ 295 R IP+ ++R VEF+ E+ HL E+EKSEQAKT LR+ I IL++L+ Sbjct: 1762 RSIPSEQKRLVEFKSEVIHLMEIEKSEQAKTFLRRSIEILQDLE 1805