BLASTX nr result
ID: Ophiopogon27_contig00008353
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00008353 (487 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020242084.1| proteasome-associated protein ECM29 homolog ... 67 6e-10 ref|XP_020242083.1| proteasome-associated protein ECM29 homolog ... 67 6e-10 ref|XP_020242082.1| proteasome-associated protein ECM29 homolog ... 67 6e-10 ref|XP_010922049.1| PREDICTED: proteasome-associated protein ECM... 60 1e-07 ref|XP_010922048.1| PREDICTED: proteasome-associated protein ECM... 60 1e-07 ref|XP_010922045.1| PREDICTED: proteasome-associated protein ECM... 60 1e-07 ref|XP_009410433.1| PREDICTED: proteasome-associated protein ECM... 57 3e-06 gb|OAY74829.1| Proteasome-associated protein ECM [Ananas comosus] 56 6e-06 >ref|XP_020242084.1| proteasome-associated protein ECM29 homolog isoform X3 [Asparagus officinalis] Length = 1637 Score = 67.4 bits (163), Expect = 6e-10 Identities = 31/43 (72%), Positives = 38/43 (88%) Frame = -3 Query: 485 RNVEFQDELIHLCEVEKSEQAKTLLRKVIAILEELRGEDAQMI 357 +N+EF DELIHLCEVEKSEQAKTLL+KV+A+LEEL E+ M+ Sbjct: 1593 KNIEFSDELIHLCEVEKSEQAKTLLQKVVALLEELGEENTPMV 1635 >ref|XP_020242083.1| proteasome-associated protein ECM29 homolog isoform X2 [Asparagus officinalis] Length = 1793 Score = 67.4 bits (163), Expect = 6e-10 Identities = 31/43 (72%), Positives = 38/43 (88%) Frame = -3 Query: 485 RNVEFQDELIHLCEVEKSEQAKTLLRKVIAILEELRGEDAQMI 357 +N+EF DELIHLCEVEKSEQAKTLL+KV+A+LEEL E+ M+ Sbjct: 1749 KNIEFSDELIHLCEVEKSEQAKTLLQKVVALLEELGEENTPMV 1791 >ref|XP_020242082.1| proteasome-associated protein ECM29 homolog isoform X1 [Asparagus officinalis] gb|ONK61486.1| uncharacterized protein A4U43_C08F30410 [Asparagus officinalis] Length = 1813 Score = 67.4 bits (163), Expect = 6e-10 Identities = 31/43 (72%), Positives = 38/43 (88%) Frame = -3 Query: 485 RNVEFQDELIHLCEVEKSEQAKTLLRKVIAILEELRGEDAQMI 357 +N+EF DELIHLCEVEKSEQAKTLL+KV+A+LEEL E+ M+ Sbjct: 1769 KNIEFSDELIHLCEVEKSEQAKTLLQKVVALLEELGEENTPMV 1811 >ref|XP_010922049.1| PREDICTED: proteasome-associated protein ECM29 homolog isoform X3 [Elaeis guineensis] Length = 1763 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = -3 Query: 485 RNVEFQDELIHLCEVEKSEQAKTLLRKVIAILEELRGEDAQM 360 +++EF+DEL+HLCEVEKSEQAKTLLRK +AI E+L E M Sbjct: 1721 KHIEFKDELVHLCEVEKSEQAKTLLRKCLAIFEDLDREITSM 1762 >ref|XP_010922048.1| PREDICTED: proteasome-associated protein ECM29 homolog isoform X2 [Elaeis guineensis] Length = 1814 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = -3 Query: 485 RNVEFQDELIHLCEVEKSEQAKTLLRKVIAILEELRGEDAQM 360 +++EF+DEL+HLCEVEKSEQAKTLLRK +AI E+L E M Sbjct: 1772 KHIEFKDELVHLCEVEKSEQAKTLLRKCLAIFEDLDREITSM 1813 >ref|XP_010922045.1| PREDICTED: proteasome-associated protein ECM29 homolog isoform X1 [Elaeis guineensis] Length = 1819 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = -3 Query: 485 RNVEFQDELIHLCEVEKSEQAKTLLRKVIAILEELRGEDAQM 360 +++EF+DEL+HLCEVEKSEQAKTLLRK +AI E+L E M Sbjct: 1777 KHIEFKDELVHLCEVEKSEQAKTLLRKCLAIFEDLDREITSM 1818 >ref|XP_009410433.1| PREDICTED: proteasome-associated protein ECM29 homolog [Musa acuminata subsp. malaccensis] Length = 1816 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = -3 Query: 482 NVEFQDELIHLCEVEKSEQAKTLLRKVIAILEELR 378 +VE +DEL+HLCEVEKSEQAKTLLR+ I ILE+L+ Sbjct: 1772 DVELKDELVHLCEVEKSEQAKTLLRQCITILEDLK 1806 >gb|OAY74829.1| Proteasome-associated protein ECM [Ananas comosus] Length = 1818 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = -3 Query: 485 RNVEFQDELIHLCEVEKSEQAKTLLRKVIAILEELRGEDA 366 +N+EF+D L HLC VEKSEQAKT+LRK AILEEL E A Sbjct: 1777 KNIEFKDALTHLCGVEKSEQAKTVLRKCTAILEELELEIA 1816