BLASTX nr result
ID: Ophiopogon27_contig00008250
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00008250 (411 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020274538.1| probable zinc metalloprotease EGY1, chloropl... 72 6e-12 gb|OVA16433.1| Peptidase M50 [Macleaya cordata] 69 5e-11 ref|XP_019457393.1| PREDICTED: probable zinc metalloprotease EGY... 65 7e-11 gb|ERM93570.1| hypothetical protein AMTR_s00004p00107700 [Ambore... 68 1e-10 ref|XP_006826333.2| probable zinc metalloprotease EGY1, chloropl... 68 1e-10 ref|XP_010909992.1| PREDICTED: probable zinc metalloprotease EGY... 67 3e-10 ref|XP_008791388.1| PREDICTED: probable zinc metalloprotease EGY... 67 3e-10 ref|XP_010909990.1| PREDICTED: probable zinc metalloprotease EGY... 67 3e-10 dbj|GAY33114.1| hypothetical protein CUMW_287530 [Citrus unshiu] 62 6e-10 ref|XP_020092554.1| probable zinc metalloprotease EGY1, chloropl... 66 8e-10 ref|XP_010266698.1| PREDICTED: probable zinc metalloprotease EGY... 66 8e-10 ref|XP_023739364.1| probable zinc metalloprotease EGY1, chloropl... 66 8e-10 gb|OAY73245.1| putative zinc metalloprotease EGY1, chloroplastic... 66 9e-10 gb|KHG07238.1| High-affinity nickel transport nic1 [Gossypium ar... 65 1e-09 gb|PPS10082.1| hypothetical protein GOBAR_AA10556 [Gossypium bar... 65 1e-09 ref|XP_017627701.1| PREDICTED: probable zinc metalloprotease EGY... 65 1e-09 ref|XP_016697774.1| PREDICTED: probable zinc metalloprotease EGY... 65 1e-09 ref|XP_012492480.1| PREDICTED: probable zinc metalloprotease EGY... 65 1e-09 ref|XP_022000695.1| probable zinc metalloprotease EGY1, chloropl... 65 1e-09 gb|AAO37991.2| expressed protein [Oryza sativa Japonica Group] >... 65 2e-09 >ref|XP_020274538.1| probable zinc metalloprotease EGY1, chloroplastic [Asparagus officinalis] ref|XP_020274539.1| probable zinc metalloprotease EGY1, chloroplastic [Asparagus officinalis] gb|ONK65056.1| uncharacterized protein A4U43_C07F33050 [Asparagus officinalis] Length = 541 Score = 72.0 bits (175), Expect = 6e-12 Identities = 35/51 (68%), Positives = 35/51 (68%) Frame = +1 Query: 1 FGLTTYAMXXXXXXXXXXXXXXXXYVLICQRAPEKPCLNDVSEVGTWRRTA 153 FGLTTYAM YVLICQRAPEKPCLNDVSEVGTWRRTA Sbjct: 460 FGLTTYAMLGLGVLGGPLSLPWGLYVLICQRAPEKPCLNDVSEVGTWRRTA 510 >gb|OVA16433.1| Peptidase M50 [Macleaya cordata] Length = 551 Score = 69.3 bits (168), Expect = 5e-11 Identities = 33/51 (64%), Positives = 34/51 (66%) Frame = +1 Query: 1 FGLTTYAMXXXXXXXXXXXXXXXXYVLICQRAPEKPCLNDVSEVGTWRRTA 153 FGLTTYA+ YVLICQR PEKPCLNDVSEVGTWRRTA Sbjct: 470 FGLTTYALLGLGVLGGPLSLPWGLYVLICQRTPEKPCLNDVSEVGTWRRTA 520 >ref|XP_019457393.1| PREDICTED: probable zinc metalloprotease EGY1, chloroplastic [Lupinus angustifolius] Length = 101 Score = 64.7 bits (156), Expect = 7e-11 Identities = 29/50 (58%), Positives = 32/50 (64%) Frame = +1 Query: 1 FGLTTYAMXXXXXXXXXXXXXXXXYVLICQRAPEKPCLNDVSEVGTWRRT 150 FGLTTY M YV++CQR PEKPCLNDVSEVGTWR+T Sbjct: 20 FGLTTYTMLGLGVLGGPLSLPWGLYVILCQRTPEKPCLNDVSEVGTWRKT 69 >gb|ERM93570.1| hypothetical protein AMTR_s00004p00107700 [Amborella trichopoda] Length = 556 Score = 68.2 bits (165), Expect = 1e-10 Identities = 32/51 (62%), Positives = 33/51 (64%) Frame = +1 Query: 1 FGLTTYAMXXXXXXXXXXXXXXXXYVLICQRAPEKPCLNDVSEVGTWRRTA 153 FGLTTYA Y+LICQR PEKPCLNDVSEVGTWRRTA Sbjct: 475 FGLTTYAFLGLGVLGGPLSLPWGLYILICQRTPEKPCLNDVSEVGTWRRTA 525 >ref|XP_006826333.2| probable zinc metalloprotease EGY1, chloroplastic [Amborella trichopoda] Length = 566 Score = 68.2 bits (165), Expect = 1e-10 Identities = 32/51 (62%), Positives = 33/51 (64%) Frame = +1 Query: 1 FGLTTYAMXXXXXXXXXXXXXXXXYVLICQRAPEKPCLNDVSEVGTWRRTA 153 FGLTTYA Y+LICQR PEKPCLNDVSEVGTWRRTA Sbjct: 485 FGLTTYAFLGLGVLGGPLSLPWGLYILICQRTPEKPCLNDVSEVGTWRRTA 535 >ref|XP_010909992.1| PREDICTED: probable zinc metalloprotease EGY1, chloroplastic isoform X3 [Elaeis guineensis] Length = 510 Score = 67.0 bits (162), Expect = 3e-10 Identities = 31/51 (60%), Positives = 34/51 (66%) Frame = +1 Query: 1 FGLTTYAMXXXXXXXXXXXXXXXXYVLICQRAPEKPCLNDVSEVGTWRRTA 153 FGLTTY++ YVLICQR PEKPCLNDV+EVGTWRRTA Sbjct: 429 FGLTTYSLLGLGVLGGQLSLPWGLYVLICQRTPEKPCLNDVTEVGTWRRTA 479 >ref|XP_008791388.1| PREDICTED: probable zinc metalloprotease EGY1, chloroplastic [Phoenix dactylifera] Length = 577 Score = 67.0 bits (162), Expect = 3e-10 Identities = 31/51 (60%), Positives = 34/51 (66%) Frame = +1 Query: 1 FGLTTYAMXXXXXXXXXXXXXXXXYVLICQRAPEKPCLNDVSEVGTWRRTA 153 FGLTTY++ YVLICQR PEKPCLNDV+EVGTWRRTA Sbjct: 496 FGLTTYSLLGLGVLGGQLSLPWGLYVLICQRTPEKPCLNDVTEVGTWRRTA 546 >ref|XP_010909990.1| PREDICTED: probable zinc metalloprotease EGY1, chloroplastic isoform X1 [Elaeis guineensis] Length = 579 Score = 67.0 bits (162), Expect = 3e-10 Identities = 31/51 (60%), Positives = 34/51 (66%) Frame = +1 Query: 1 FGLTTYAMXXXXXXXXXXXXXXXXYVLICQRAPEKPCLNDVSEVGTWRRTA 153 FGLTTY++ YVLICQR PEKPCLNDV+EVGTWRRTA Sbjct: 498 FGLTTYSLLGLGVLGGQLSLPWGLYVLICQRTPEKPCLNDVTEVGTWRRTA 548 >dbj|GAY33114.1| hypothetical protein CUMW_287530 [Citrus unshiu] Length = 106 Score = 62.4 bits (150), Expect = 6e-10 Identities = 28/49 (57%), Positives = 31/49 (63%) Frame = +1 Query: 1 FGLTTYAMXXXXXXXXXXXXXXXXYVLICQRAPEKPCLNDVSEVGTWRR 147 FGLTTY M YV+ICQR PEKPCLNDV+EVGTWR+ Sbjct: 25 FGLTTYTMLGLGVLGGPLSLPWGLYVIICQRTPEKPCLNDVTEVGTWRK 73 >ref|XP_020092554.1| probable zinc metalloprotease EGY1, chloroplastic [Ananas comosus] Length = 546 Score = 65.9 bits (159), Expect = 8e-10 Identities = 30/51 (58%), Positives = 34/51 (66%) Frame = +1 Query: 1 FGLTTYAMXXXXXXXXXXXXXXXXYVLICQRAPEKPCLNDVSEVGTWRRTA 153 FGLTTY++ YVLICQR+PEKPCLNDVSE GTWR+TA Sbjct: 465 FGLTTYSLLGLGVLGGPLSLPWGLYVLICQRSPEKPCLNDVSEAGTWRKTA 515 >ref|XP_010266698.1| PREDICTED: probable zinc metalloprotease EGY1, chloroplastic [Nelumbo nucifera] Length = 546 Score = 65.9 bits (159), Expect = 8e-10 Identities = 31/51 (60%), Positives = 32/51 (62%) Frame = +1 Query: 1 FGLTTYAMXXXXXXXXXXXXXXXXYVLICQRAPEKPCLNDVSEVGTWRRTA 153 FGL TY + YVLICQR PEKPCLNDVSEVGTWRRTA Sbjct: 465 FGLATYTLLGLGVLGGPLSLPWGLYVLICQRTPEKPCLNDVSEVGTWRRTA 515 >ref|XP_023739364.1| probable zinc metalloprotease EGY1, chloroplastic [Lactuca sativa] ref|XP_023739365.1| probable zinc metalloprotease EGY1, chloroplastic [Lactuca sativa] gb|PLY69510.1| hypothetical protein LSAT_6X31540 [Lactuca sativa] Length = 573 Score = 65.9 bits (159), Expect = 8e-10 Identities = 30/50 (60%), Positives = 34/50 (68%) Frame = +1 Query: 1 FGLTTYAMXXXXXXXXXXXXXXXXYVLICQRAPEKPCLNDVSEVGTWRRT 150 FGLTTY++ YVLICQR+PEKPCLNDV+EVGTWRRT Sbjct: 492 FGLTTYSLLGFGVLGGPLSLPWGLYVLICQRSPEKPCLNDVTEVGTWRRT 541 >gb|OAY73245.1| putative zinc metalloprotease EGY1, chloroplastic [Ananas comosus] Length = 957 Score = 65.9 bits (159), Expect = 9e-10 Identities = 30/51 (58%), Positives = 34/51 (66%) Frame = +1 Query: 1 FGLTTYAMXXXXXXXXXXXXXXXXYVLICQRAPEKPCLNDVSEVGTWRRTA 153 FGLTTY++ YVLICQR+PEKPCLNDVSE GTWR+TA Sbjct: 426 FGLTTYSLLGLGVLGGPLSLPWGLYVLICQRSPEKPCLNDVSEAGTWRKTA 476 >gb|KHG07238.1| High-affinity nickel transport nic1 [Gossypium arboreum] Length = 445 Score = 65.5 bits (158), Expect = 1e-09 Identities = 30/51 (58%), Positives = 33/51 (64%) Frame = +1 Query: 1 FGLTTYAMXXXXXXXXXXXXXXXXYVLICQRAPEKPCLNDVSEVGTWRRTA 153 FGLTTY + YVLICQR PEKPCLNDV+EVGTWR+TA Sbjct: 364 FGLTTYTLLGLGVIGGPLSLPWGLYVLICQRTPEKPCLNDVTEVGTWRKTA 414 >gb|PPS10082.1| hypothetical protein GOBAR_AA10556 [Gossypium barbadense] Length = 555 Score = 65.5 bits (158), Expect = 1e-09 Identities = 30/51 (58%), Positives = 33/51 (64%) Frame = +1 Query: 1 FGLTTYAMXXXXXXXXXXXXXXXXYVLICQRAPEKPCLNDVSEVGTWRRTA 153 FGLTTY + YVLICQR PEKPCLNDV+EVGTWR+TA Sbjct: 478 FGLTTYTLLGLGVIGGPLSLPWGLYVLICQRTPEKPCLNDVTEVGTWRKTA 528 >ref|XP_017627701.1| PREDICTED: probable zinc metalloprotease EGY1, chloroplastic [Gossypium arboreum] Length = 559 Score = 65.5 bits (158), Expect = 1e-09 Identities = 30/51 (58%), Positives = 33/51 (64%) Frame = +1 Query: 1 FGLTTYAMXXXXXXXXXXXXXXXXYVLICQRAPEKPCLNDVSEVGTWRRTA 153 FGLTTY + YVLICQR PEKPCLNDV+EVGTWR+TA Sbjct: 478 FGLTTYTLLGLGVIGGPLSLPWGLYVLICQRTPEKPCLNDVTEVGTWRKTA 528 >ref|XP_016697774.1| PREDICTED: probable zinc metalloprotease EGY1, chloroplastic isoform X1 [Gossypium hirsutum] gb|PPD95777.1| hypothetical protein GOBAR_DD07212 [Gossypium barbadense] Length = 559 Score = 65.5 bits (158), Expect = 1e-09 Identities = 30/51 (58%), Positives = 33/51 (64%) Frame = +1 Query: 1 FGLTTYAMXXXXXXXXXXXXXXXXYVLICQRAPEKPCLNDVSEVGTWRRTA 153 FGLTTY + YVLICQR PEKPCLNDV+EVGTWR+TA Sbjct: 478 FGLTTYTLLGLGVIGGPLSLPWGLYVLICQRTPEKPCLNDVTEVGTWRKTA 528 >ref|XP_012492480.1| PREDICTED: probable zinc metalloprotease EGY1, chloroplastic isoform X1 [Gossypium raimondii] gb|KJB44504.1| hypothetical protein B456_007G256500 [Gossypium raimondii] Length = 559 Score = 65.5 bits (158), Expect = 1e-09 Identities = 30/51 (58%), Positives = 33/51 (64%) Frame = +1 Query: 1 FGLTTYAMXXXXXXXXXXXXXXXXYVLICQRAPEKPCLNDVSEVGTWRRTA 153 FGLTTY + YVLICQR PEKPCLNDV+EVGTWR+TA Sbjct: 478 FGLTTYTLLGLGVIGGPLSLPWGLYVLICQRTPEKPCLNDVTEVGTWRKTA 528 >ref|XP_022000695.1| probable zinc metalloprotease EGY1, chloroplastic [Helianthus annuus] gb|OTG01151.1| putative peptidase M50 family protein [Helianthus annuus] Length = 566 Score = 65.5 bits (158), Expect = 1e-09 Identities = 31/51 (60%), Positives = 34/51 (66%) Frame = +1 Query: 1 FGLTTYAMXXXXXXXXXXXXXXXXYVLICQRAPEKPCLNDVSEVGTWRRTA 153 FGLTTY++ YVLICQRA EKPCLNDV+EVGTWRRTA Sbjct: 485 FGLTTYSLLGFGVLGGPLSLPWGLYVLICQRAAEKPCLNDVTEVGTWRRTA 535 >gb|AAO37991.2| expressed protein [Oryza sativa Japonica Group] gb|ABF99299.1| Sterol-regulatory element binding protein site 2 protease containing protein, expressed [Oryza sativa Japonica Group] gb|ABF99300.1| Sterol-regulatory element binding protein site 2 protease containing protein, expressed [Oryza sativa Japonica Group] dbj|BAG89215.1| unnamed protein product [Oryza sativa Japonica Group] gb|EEC76315.1| hypothetical protein OsI_13853 [Oryza sativa Indica Group] dbj|BAS86794.1| Os03g0792400 [Oryza sativa Japonica Group] Length = 462 Score = 65.1 bits (157), Expect = 2e-09 Identities = 30/51 (58%), Positives = 33/51 (64%) Frame = +1 Query: 1 FGLTTYAMXXXXXXXXXXXXXXXXYVLICQRAPEKPCLNDVSEVGTWRRTA 153 FGLTTY++ YVLICQR PEKPCLNDVS+VGTWRR A Sbjct: 381 FGLTTYSLLGLGVLGGPLSLPWGLYVLICQRTPEKPCLNDVSDVGTWRRAA 431