BLASTX nr result
ID: Ophiopogon27_contig00008150
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00008150 (400 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020274687.1| glutamate-rich WD repeat-containing protein ... 79 2e-14 ref|XP_020691393.1| glutamate-rich WD repeat-containing protein ... 70 2e-11 gb|PKU87934.1| WD-40 repeat-containing protein MSI2 [Dendrobium ... 70 2e-11 gb|OAY64946.1| Glutamate-rich WD repeat-containing protein 1 [An... 69 4e-11 ref|XP_020102142.1| glutamate-rich WD repeat-containing protein ... 69 4e-11 ref|XP_015889184.1| PREDICTED: glutamate-rich WD repeat-containi... 67 2e-10 gb|ONM42110.1| Transducin family protein / WD-40 repeat family p... 64 2e-10 ref|XP_003577881.1| PREDICTED: glutamate-rich WD repeat-containi... 67 4e-10 ref|XP_020198393.1| glutamate-rich WD repeat-containing protein ... 67 4e-10 dbj|BAJ98726.1| predicted protein [Hordeum vulgare subsp. vulgare] 67 4e-10 gb|KQJ89556.1| hypothetical protein BRADI_4g26390v3 [Brachypodiu... 67 4e-10 gb|PAN52639.1| hypothetical protein PAHAL_J02113 [Panicum hallii] 64 5e-10 gb|KMZ62347.1| putative WD-repeat protein [Zostera marina] 66 5e-10 gb|ONM42104.1| Transducin family protein / WD-40 repeat family p... 64 7e-10 ref|XP_018858534.1| PREDICTED: glutamate-rich WD repeat-containi... 66 7e-10 ref|XP_008450849.1| PREDICTED: glutamate-rich WD repeat-containi... 66 7e-10 ref|XP_004135709.1| PREDICTED: glutamate-rich WD repeat-containi... 66 7e-10 gb|KGN66232.1| hypothetical protein Csa_1G587430 [Cucumis sativus] 66 7e-10 ref|XP_008809056.1| PREDICTED: glutamate-rich WD repeat-containi... 65 1e-09 ref|XP_018829886.1| PREDICTED: glutamate-rich WD repeat-containi... 65 1e-09 >ref|XP_020274687.1| glutamate-rich WD repeat-containing protein 1 [Asparagus officinalis] gb|ONK63611.1| uncharacterized protein A4U43_C07F17040 [Asparagus officinalis] Length = 469 Score = 79.0 bits (193), Expect = 2e-14 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 398 EIHWHQQIPGMLVSTAADGFNVIMPANIETTIPGAAS 288 EIHWHQQIPGMLVSTAADGFNV+MPANIETTIPGAAS Sbjct: 433 EIHWHQQIPGMLVSTAADGFNVLMPANIETTIPGAAS 469 >ref|XP_020691393.1| glutamate-rich WD repeat-containing protein 1 [Dendrobium catenatum] Length = 467 Score = 70.5 bits (171), Expect = 2e-11 Identities = 28/35 (80%), Positives = 34/35 (97%) Frame = -3 Query: 398 EIHWHQQIPGMLVSTAADGFNVIMPANIETTIPGA 294 E+HWHQQIPGM++STAADGFN++MPANIETT+P A Sbjct: 433 ELHWHQQIPGMIISTAADGFNILMPANIETTLPSA 467 >gb|PKU87934.1| WD-40 repeat-containing protein MSI2 [Dendrobium catenatum] Length = 532 Score = 70.5 bits (171), Expect = 2e-11 Identities = 28/35 (80%), Positives = 34/35 (97%) Frame = -3 Query: 398 EIHWHQQIPGMLVSTAADGFNVIMPANIETTIPGA 294 E+HWHQQIPGM++STAADGFN++MPANIETT+P A Sbjct: 498 ELHWHQQIPGMIISTAADGFNILMPANIETTLPSA 532 >gb|OAY64946.1| Glutamate-rich WD repeat-containing protein 1 [Ananas comosus] Length = 446 Score = 69.3 bits (168), Expect = 4e-11 Identities = 28/37 (75%), Positives = 35/37 (94%) Frame = -3 Query: 398 EIHWHQQIPGMLVSTAADGFNVIMPANIETTIPGAAS 288 E+HWH QIPGM++STAADGFNV+MP+NIETT+P AA+ Sbjct: 410 ELHWHPQIPGMIISTAADGFNVLMPSNIETTLPSAAT 446 >ref|XP_020102142.1| glutamate-rich WD repeat-containing protein 1 [Ananas comosus] Length = 479 Score = 69.3 bits (168), Expect = 4e-11 Identities = 28/37 (75%), Positives = 35/37 (94%) Frame = -3 Query: 398 EIHWHQQIPGMLVSTAADGFNVIMPANIETTIPGAAS 288 E+HWH QIPGM++STAADGFNV+MP+NIETT+P AA+ Sbjct: 443 ELHWHPQIPGMIISTAADGFNVLMPSNIETTLPSAAT 479 >ref|XP_015889184.1| PREDICTED: glutamate-rich WD repeat-containing protein 1 [Ziziphus jujuba] Length = 476 Score = 67.4 bits (163), Expect = 2e-10 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = -3 Query: 398 EIHWHQQIPGMLVSTAADGFNVIMPANIETTIPGAAS 288 E+HWH QIPGMLVSTAADGFNV+MP+NI+TT+P A+ Sbjct: 440 ELHWHTQIPGMLVSTAADGFNVLMPSNIQTTLPSEAA 476 >gb|ONM42110.1| Transducin family protein / WD-40 repeat family protein [Zea mays] Length = 147 Score = 64.3 bits (155), Expect = 2e-10 Identities = 25/35 (71%), Positives = 32/35 (91%) Frame = -3 Query: 398 EIHWHQQIPGMLVSTAADGFNVIMPANIETTIPGA 294 E+HWH QIP M++STA DGFNV+MP+NI+TTIPG+ Sbjct: 103 EVHWHPQIPSMIISTAIDGFNVLMPSNIDTTIPGS 137 >ref|XP_003577881.1| PREDICTED: glutamate-rich WD repeat-containing protein 1 [Brachypodium distachyon] Length = 475 Score = 66.6 bits (161), Expect = 4e-10 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -3 Query: 398 EIHWHQQIPGMLVSTAADGFNVIMPANIETTIPGA 294 E+HWH QIPGM+VSTAADGFNV+MP+NI+TTI GA Sbjct: 437 ELHWHPQIPGMIVSTAADGFNVLMPSNIDTTIAGA 471 >ref|XP_020198393.1| glutamate-rich WD repeat-containing protein 1 [Aegilops tauschii subsp. tauschii] Length = 482 Score = 66.6 bits (161), Expect = 4e-10 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -3 Query: 398 EIHWHQQIPGMLVSTAADGFNVIMPANIETTIPGA 294 E+HWH QIPGM+VSTAADGFNV+MP+NI+TTI GA Sbjct: 439 ELHWHPQIPGMIVSTAADGFNVLMPSNIDTTIAGA 473 >dbj|BAJ98726.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 482 Score = 66.6 bits (161), Expect = 4e-10 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -3 Query: 398 EIHWHQQIPGMLVSTAADGFNVIMPANIETTIPGA 294 E+HWH QIPGM+VSTAADGFNV+MP+NI+TTI GA Sbjct: 439 ELHWHPQIPGMIVSTAADGFNVLMPSNIDTTIAGA 473 >gb|KQJ89556.1| hypothetical protein BRADI_4g26390v3 [Brachypodium distachyon] Length = 523 Score = 66.6 bits (161), Expect = 4e-10 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -3 Query: 398 EIHWHQQIPGMLVSTAADGFNVIMPANIETTIPGA 294 E+HWH QIPGM+VSTAADGFNV+MP+NI+TTI GA Sbjct: 485 ELHWHPQIPGMIVSTAADGFNVLMPSNIDTTIAGA 519 >gb|PAN52639.1| hypothetical protein PAHAL_J02113 [Panicum hallii] Length = 148 Score = 63.5 bits (153), Expect = 5e-10 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = -3 Query: 398 EIHWHQQIPGMLVSTAADGFNVIMPANIETTIPG 297 E+HWH QIP M++STA DGFNV+MP+NI+TTIPG Sbjct: 104 ELHWHPQIPSMIISTAIDGFNVLMPSNIDTTIPG 137 >gb|KMZ62347.1| putative WD-repeat protein [Zostera marina] Length = 469 Score = 66.2 bits (160), Expect = 5e-10 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -3 Query: 398 EIHWHQQIPGMLVSTAADGFNVIMPANIETTIPGAAS 288 E+HWHQQIPGMLVSTAAD FN++MP N+E T+P A+S Sbjct: 432 ELHWHQQIPGMLVSTAADSFNILMPVNLENTLPPASS 468 >gb|ONM42104.1| Transducin family protein / WD-40 repeat family protein [Zea mays] Length = 203 Score = 64.3 bits (155), Expect = 7e-10 Identities = 25/35 (71%), Positives = 32/35 (91%) Frame = -3 Query: 398 EIHWHQQIPGMLVSTAADGFNVIMPANIETTIPGA 294 E+HWH QIP M++STA DGFNV+MP+NI+TTIPG+ Sbjct: 159 EVHWHPQIPSMIISTAIDGFNVLMPSNIDTTIPGS 193 >ref|XP_018858534.1| PREDICTED: glutamate-rich WD repeat-containing protein 1-like [Juglans regia] Length = 473 Score = 65.9 bits (159), Expect = 7e-10 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -3 Query: 398 EIHWHQQIPGMLVSTAADGFNVIMPANIETTIP 300 EIHWH QIPGM+VSTAADGFN++MP+NI+TT+P Sbjct: 437 EIHWHSQIPGMIVSTAADGFNILMPSNIQTTLP 469 >ref|XP_008450849.1| PREDICTED: glutamate-rich WD repeat-containing protein 1 [Cucumis melo] Length = 475 Score = 65.9 bits (159), Expect = 7e-10 Identities = 26/37 (70%), Positives = 34/37 (91%) Frame = -3 Query: 398 EIHWHQQIPGMLVSTAADGFNVIMPANIETTIPGAAS 288 E+HWH QIPGM+VSTAADGFN++MP+NI+TT+P A+ Sbjct: 438 ELHWHAQIPGMIVSTAADGFNILMPSNIQTTLPSDAA 474 >ref|XP_004135709.1| PREDICTED: glutamate-rich WD repeat-containing protein 1 [Cucumis sativus] Length = 475 Score = 65.9 bits (159), Expect = 7e-10 Identities = 26/37 (70%), Positives = 34/37 (91%) Frame = -3 Query: 398 EIHWHQQIPGMLVSTAADGFNVIMPANIETTIPGAAS 288 E+HWH QIPGM+VSTAADGFN++MP+NI+TT+P A+ Sbjct: 438 ELHWHAQIPGMIVSTAADGFNILMPSNIQTTLPSDAA 474 >gb|KGN66232.1| hypothetical protein Csa_1G587430 [Cucumis sativus] Length = 476 Score = 65.9 bits (159), Expect = 7e-10 Identities = 26/37 (70%), Positives = 34/37 (91%) Frame = -3 Query: 398 EIHWHQQIPGMLVSTAADGFNVIMPANIETTIPGAAS 288 E+HWH QIPGM+VSTAADGFN++MP+NI+TT+P A+ Sbjct: 439 ELHWHAQIPGMIVSTAADGFNILMPSNIQTTLPSDAA 475 >ref|XP_008809056.1| PREDICTED: glutamate-rich WD repeat-containing protein 1 [Phoenix dactylifera] Length = 467 Score = 65.5 bits (158), Expect = 1e-09 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -3 Query: 398 EIHWHQQIPGMLVSTAADGFNVIMPANIETTIPGAAS 288 E+HWH QIPGM++STAADGFN+ MPANIETT+P + Sbjct: 431 ELHWHTQIPGMIISTAADGFNISMPANIETTLPSGGA 467 >ref|XP_018829886.1| PREDICTED: glutamate-rich WD repeat-containing protein 1-like [Juglans regia] Length = 487 Score = 65.5 bits (158), Expect = 1e-09 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -3 Query: 398 EIHWHQQIPGMLVSTAADGFNVIMPANIETTIP 300 EIHWH QIPGM+VSTAADGFN++MP+NI+TT+P Sbjct: 451 EIHWHSQIPGMVVSTAADGFNILMPSNIQTTLP 483