BLASTX nr result
ID: Ophiopogon27_contig00007991
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00007991 (487 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNT00199.1| hypothetical protein POPTR_015G034000v3 [Populus ... 62 5e-08 ref|XP_006374214.1| cyclic nucleotide-gated ion channel 20 famil... 62 5e-08 ref|XP_020980123.1| probable cyclic nucleotide-gated ion channel... 61 7e-08 ref|XP_020998926.1| probable cyclic nucleotide-gated ion channel... 61 7e-08 ref|XP_016203339.1| probable cyclic nucleotide-gated ion channel... 61 7e-08 ref|XP_015966822.1| probable cyclic nucleotide-gated ion channel... 61 7e-08 ref|XP_020980120.1| probable cyclic nucleotide-gated ion channel... 61 7e-08 ref|XP_015966821.1| probable cyclic nucleotide-gated ion channel... 61 7e-08 ref|XP_013452788.1| cyclic nucleotide-gated cation channel prote... 61 9e-08 ref|XP_013452790.1| cyclic nucleotide-gated cation channel prote... 61 1e-07 ref|XP_013452789.1| cyclic nucleotide-gated cation channel prote... 61 1e-07 ref|XP_004515287.1| PREDICTED: probable cyclic nucleotide-gated ... 61 1e-07 ref|XP_011035549.1| PREDICTED: probable cyclic nucleotide-gated ... 61 1e-07 ref|XP_011035548.1| PREDICTED: probable cyclic nucleotide-gated ... 61 1e-07 ref|XP_006599725.1| PREDICTED: probable cyclic nucleotide-gated ... 59 4e-07 ref|XP_021683421.1| probable cyclic nucleotide-gated ion channel... 59 4e-07 ref|XP_006599724.1| PREDICTED: probable cyclic nucleotide-gated ... 59 5e-07 gb|KHN24538.1| Putative cyclic nucleotide-gated ion channel 20, ... 59 5e-07 ref|XP_003548315.1| PREDICTED: probable cyclic nucleotide-gated ... 59 5e-07 ref|XP_021683353.1| probable cyclic nucleotide-gated ion channel... 59 5e-07 >gb|PNT00199.1| hypothetical protein POPTR_015G034000v3 [Populus trichocarpa] Length = 785 Score = 61.6 bits (148), Expect = 5e-08 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = +3 Query: 3 QSPYWRCMAATRIQVAWRYRQKRLKRANTSQVDGLPPRSN 122 QSPYWR +AATRIQVAWRYRQKRLK + T+ + P SN Sbjct: 739 QSPYWRALAATRIQVAWRYRQKRLKHSKTTHSNHFAPHSN 778 >ref|XP_006374214.1| cyclic nucleotide-gated ion channel 20 family protein [Populus trichocarpa] Length = 785 Score = 61.6 bits (148), Expect = 5e-08 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = +3 Query: 3 QSPYWRCMAATRIQVAWRYRQKRLKRANTSQVDGLPPRSN 122 QSPYWR +AATRIQVAWRYRQKRLK + T+ + P SN Sbjct: 739 QSPYWRALAATRIQVAWRYRQKRLKHSKTTHSNHFAPHSN 778 >ref|XP_020980123.1| probable cyclic nucleotide-gated ion channel 20, chloroplastic isoform X3 [Arachis ipaensis] Length = 750 Score = 61.2 bits (147), Expect = 7e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 3 QSPYWRCMAATRIQVAWRYRQKRLKRANTSQ 95 +SPYWRC AATRIQVAWRYR+KRL RA+TSQ Sbjct: 713 ESPYWRCFAATRIQVAWRYRKKRLSRADTSQ 743 >ref|XP_020998926.1| probable cyclic nucleotide-gated ion channel 20, chloroplastic isoform X3 [Arachis duranensis] Length = 751 Score = 61.2 bits (147), Expect = 7e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 3 QSPYWRCMAATRIQVAWRYRQKRLKRANTSQ 95 +SPYWRC AATRIQVAWRYR+KRL RA+TSQ Sbjct: 714 ESPYWRCFAATRIQVAWRYRKKRLSRADTSQ 744 >ref|XP_016203339.1| probable cyclic nucleotide-gated ion channel 20, chloroplastic isoform X2 [Arachis ipaensis] ref|XP_016203340.1| probable cyclic nucleotide-gated ion channel 20, chloroplastic isoform X2 [Arachis ipaensis] ref|XP_020980121.1| probable cyclic nucleotide-gated ion channel 20, chloroplastic isoform X2 [Arachis ipaensis] ref|XP_020980122.1| probable cyclic nucleotide-gated ion channel 20, chloroplastic isoform X2 [Arachis ipaensis] Length = 766 Score = 61.2 bits (147), Expect = 7e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 3 QSPYWRCMAATRIQVAWRYRQKRLKRANTSQ 95 +SPYWRC AATRIQVAWRYR+KRL RA+TSQ Sbjct: 729 ESPYWRCFAATRIQVAWRYRKKRLSRADTSQ 759 >ref|XP_015966822.1| probable cyclic nucleotide-gated ion channel 20, chloroplastic isoform X2 [Arachis duranensis] ref|XP_015966823.1| probable cyclic nucleotide-gated ion channel 20, chloroplastic isoform X2 [Arachis duranensis] ref|XP_015966824.1| probable cyclic nucleotide-gated ion channel 20, chloroplastic isoform X2 [Arachis duranensis] Length = 766 Score = 61.2 bits (147), Expect = 7e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 3 QSPYWRCMAATRIQVAWRYRQKRLKRANTSQ 95 +SPYWRC AATRIQVAWRYR+KRL RA+TSQ Sbjct: 729 ESPYWRCFAATRIQVAWRYRKKRLSRADTSQ 759 >ref|XP_020980120.1| probable cyclic nucleotide-gated ion channel 20, chloroplastic isoform X1 [Arachis ipaensis] Length = 783 Score = 61.2 bits (147), Expect = 7e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 3 QSPYWRCMAATRIQVAWRYRQKRLKRANTSQ 95 +SPYWRC AATRIQVAWRYR+KRL RA+TSQ Sbjct: 746 ESPYWRCFAATRIQVAWRYRKKRLSRADTSQ 776 >ref|XP_015966821.1| probable cyclic nucleotide-gated ion channel 20, chloroplastic isoform X1 [Arachis duranensis] ref|XP_020998923.1| probable cyclic nucleotide-gated ion channel 20, chloroplastic isoform X1 [Arachis duranensis] ref|XP_020998924.1| probable cyclic nucleotide-gated ion channel 20, chloroplastic isoform X1 [Arachis duranensis] Length = 784 Score = 61.2 bits (147), Expect = 7e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 3 QSPYWRCMAATRIQVAWRYRQKRLKRANTSQ 95 +SPYWRC AATRIQVAWRYR+KRL RA+TSQ Sbjct: 747 ESPYWRCFAATRIQVAWRYRKKRLSRADTSQ 777 >ref|XP_013452788.1| cyclic nucleotide-gated cation channel protein [Medicago truncatula] gb|KEH26816.1| cyclic nucleotide-gated cation channel protein [Medicago truncatula] Length = 566 Score = 60.8 bits (146), Expect = 9e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +3 Query: 3 QSPYWRCMAATRIQVAWRYRQKRLKRANTSQ 95 +SPYWRC+AATRIQVAWRYR+KRL RA+TSQ Sbjct: 531 ESPYWRCLAATRIQVAWRYRKKRLCRADTSQ 561 >ref|XP_013452790.1| cyclic nucleotide-gated cation channel protein [Medicago truncatula] gb|KEH26818.1| cyclic nucleotide-gated cation channel protein [Medicago truncatula] Length = 727 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +3 Query: 3 QSPYWRCMAATRIQVAWRYRQKRLKRANTSQ 95 +SPYWRC+AATRIQVAWRYR+KRL RA+TSQ Sbjct: 692 ESPYWRCLAATRIQVAWRYRKKRLCRADTSQ 722 >ref|XP_013452789.1| cyclic nucleotide-gated cation channel protein [Medicago truncatula] gb|KEH26817.1| cyclic nucleotide-gated cation channel protein [Medicago truncatula] Length = 768 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +3 Query: 3 QSPYWRCMAATRIQVAWRYRQKRLKRANTSQ 95 +SPYWRC+AATRIQVAWRYR+KRL RA+TSQ Sbjct: 733 ESPYWRCLAATRIQVAWRYRKKRLCRADTSQ 763 >ref|XP_004515287.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic [Cicer arietinum] Length = 772 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = +3 Query: 3 QSPYWRCMAATRIQVAWRYRQKRLKRANTSQVDGLP 110 +SPYWRC+AATRIQVAWRYR+KRL RA TSQ + P Sbjct: 735 ESPYWRCLAATRIQVAWRYRKKRLCRAYTSQSNNEP 770 >ref|XP_011035549.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic isoform X2 [Populus euphratica] Length = 785 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/40 (70%), Positives = 30/40 (75%) Frame = +3 Query: 3 QSPYWRCMAATRIQVAWRYRQKRLKRANTSQVDGLPPRSN 122 QSPYWR +AATRIQVAWRYRQKRLK T+Q P SN Sbjct: 739 QSPYWRALAATRIQVAWRYRQKRLKHNKTTQSCHFAPHSN 778 >ref|XP_011035548.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic isoform X1 [Populus euphratica] Length = 799 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/40 (70%), Positives = 30/40 (75%) Frame = +3 Query: 3 QSPYWRCMAATRIQVAWRYRQKRLKRANTSQVDGLPPRSN 122 QSPYWR +AATRIQVAWRYRQKRLK T+Q P SN Sbjct: 753 QSPYWRALAATRIQVAWRYRQKRLKHNKTTQSCHFAPHSN 792 >ref|XP_006599725.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic isoform X3 [Glycine max] Length = 675 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 6 SPYWRCMAATRIQVAWRYRQKRLKRANTSQVD 101 SPYWR +AA RIQVAWRYR+KRL RANTSQ D Sbjct: 639 SPYWRSLAANRIQVAWRYRKKRLSRANTSQSD 670 >ref|XP_021683421.1| probable cyclic nucleotide-gated ion channel 20, chloroplastic isoform X2 [Hevea brasiliensis] Length = 694 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 3 QSPYWRCMAATRIQVAWRYRQKRLKRANTSQ 95 +SPYWR +AATRIQVAWRYRQKRLKR +TSQ Sbjct: 658 ESPYWRGLAATRIQVAWRYRQKRLKRISTSQ 688 >ref|XP_006599724.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic isoform X2 [Glycine max] gb|KRH09480.1| hypothetical protein GLYMA_16G218000 [Glycine max] gb|KRH09481.1| hypothetical protein GLYMA_16G218000 [Glycine max] Length = 742 Score = 58.9 bits (141), Expect = 5e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 6 SPYWRCMAATRIQVAWRYRQKRLKRANTSQVD 101 SPYWR +AA RIQVAWRYR+KRL RANTSQ D Sbjct: 706 SPYWRSLAANRIQVAWRYRKKRLSRANTSQSD 737 >gb|KHN24538.1| Putative cyclic nucleotide-gated ion channel 20, chloroplastic [Glycine soja] Length = 772 Score = 58.9 bits (141), Expect = 5e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 6 SPYWRCMAATRIQVAWRYRQKRLKRANTSQVD 101 SPYWR +AA RIQVAWRYR+KRL RANTSQ D Sbjct: 736 SPYWRSLAANRIQVAWRYRKKRLSRANTSQSD 767 >ref|XP_003548315.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic isoform X1 [Glycine max] ref|XP_006599723.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic isoform X1 [Glycine max] gb|KRH09482.1| hypothetical protein GLYMA_16G218000 [Glycine max] gb|KRH09483.1| hypothetical protein GLYMA_16G218000 [Glycine max] Length = 772 Score = 58.9 bits (141), Expect = 5e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 6 SPYWRCMAATRIQVAWRYRQKRLKRANTSQVD 101 SPYWR +AA RIQVAWRYR+KRL RANTSQ D Sbjct: 736 SPYWRSLAANRIQVAWRYRKKRLSRANTSQSD 767 >ref|XP_021683353.1| probable cyclic nucleotide-gated ion channel 20, chloroplastic isoform X1 [Hevea brasiliensis] Length = 777 Score = 58.9 bits (141), Expect = 5e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 3 QSPYWRCMAATRIQVAWRYRQKRLKRANTSQ 95 +SPYWR +AATRIQVAWRYRQKRLKR +TSQ Sbjct: 741 ESPYWRGLAATRIQVAWRYRQKRLKRISTSQ 771