BLASTX nr result
ID: Ophiopogon27_contig00007872
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00007872 (359 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017697020.1| PREDICTED: ATP synthase subunit O, mitochond... 68 1e-12 gb|PKA53864.1| ATP synthase subunit O, mitochondrial [Apostasia ... 69 7e-12 gb|EEF30479.1| ATP synthase delta chain, putative [Ricinus commu... 67 5e-11 ref|XP_010936761.1| PREDICTED: ATP synthase subunit O, mitochond... 66 6e-11 ref|XP_015582541.1| PREDICTED: ATP synthase subunit O, mitochond... 67 8e-11 ref|XP_021669437.1| ATP synthase subunit O, mitochondrial [Hevea... 67 1e-10 ref|XP_008787944.1| PREDICTED: ATP synthase subunit O, mitochond... 66 2e-10 gb|ONK81342.1| uncharacterized protein A4U43_C01F28000 [Asparagu... 65 2e-10 ref|XP_020251640.1| LOW QUALITY PROTEIN: ATP synthase subunit O,... 65 3e-10 ref|XP_010278998.1| PREDICTED: ATP synthase subunit O, mitochond... 65 3e-10 ref|XP_010257251.1| PREDICTED: ATP synthase subunit O, mitochond... 65 3e-10 ref|XP_022756780.1| ATP synthase subunit O, mitochondrial-like [... 65 3e-10 ref|XP_023737122.1| ATP synthase subunit O, mitochondrial-like [... 65 3e-10 ref|XP_023737123.1| ATP synthase subunit O, mitochondrial-like [... 65 3e-10 ref|XP_010940031.1| PREDICTED: ATP synthase subunit O, mitochond... 65 3e-10 sp|P22778.1|ATPO_IPOBA RecName: Full=ATP synthase subunit O, mit... 65 4e-10 dbj|BAA77508.1| F1-ATP synthase delta subunit [Ipomoea batatas] 65 4e-10 ref|XP_009393603.1| PREDICTED: ATP synthase subunit O, mitochond... 65 5e-10 gb|KVI00681.1| hypothetical protein Ccrd_021069 [Cynara carduncu... 65 6e-10 ref|XP_022018132.1| ATP synthase subunit O, mitochondrial-like [... 64 8e-10 >ref|XP_017697020.1| PREDICTED: ATP synthase subunit O, mitochondrial-like isoform X2 [Phoenix dactylifera] Length = 79 Score = 67.8 bits (164), Expect = 1e-12 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 359 GGLVIEFGQKVFDMSIKTRAKQMEKFLREPLNF 261 GGLV+EFGQKVFDMSIKTRAKQMEKFLREP+NF Sbjct: 43 GGLVVEFGQKVFDMSIKTRAKQMEKFLREPINF 75 >gb|PKA53864.1| ATP synthase subunit O, mitochondrial [Apostasia shenzhenica] Length = 194 Score = 68.9 bits (167), Expect = 7e-12 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 359 GGLVIEFGQKVFDMSIKTRAKQMEKFLREPLNF 261 GGLVIEFGQKVFDMSIKTRAKQMEKFLREPLNF Sbjct: 162 GGLVIEFGQKVFDMSIKTRAKQMEKFLREPLNF 194 >gb|EEF30479.1| ATP synthase delta chain, putative [Ricinus communis] Length = 198 Score = 66.6 bits (161), Expect = 5e-11 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -1 Query: 359 GGLVIEFGQKVFDMSIKTRAKQMEKFLREPLNF 261 GGLV+EFGQKVFDMSIKTRAKQME+FLREP+NF Sbjct: 163 GGLVVEFGQKVFDMSIKTRAKQMERFLREPINF 195 >ref|XP_010936761.1| PREDICTED: ATP synthase subunit O, mitochondrial [Elaeis guineensis] Length = 167 Score = 65.9 bits (159), Expect = 6e-11 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -1 Query: 359 GGLVIEFGQKVFDMSIKTRAKQMEKFLREPLNF 261 GGLV+EFGQKVFDMSIKTRAKQME FLREP+NF Sbjct: 131 GGLVVEFGQKVFDMSIKTRAKQMENFLREPINF 163 >ref|XP_015582541.1| PREDICTED: ATP synthase subunit O, mitochondrial [Ricinus communis] Length = 221 Score = 66.6 bits (161), Expect = 8e-11 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -1 Query: 359 GGLVIEFGQKVFDMSIKTRAKQMEKFLREPLNF 261 GGLV+EFGQKVFDMSIKTRAKQME+FLREP+NF Sbjct: 186 GGLVVEFGQKVFDMSIKTRAKQMERFLREPINF 218 >ref|XP_021669437.1| ATP synthase subunit O, mitochondrial [Hevea brasiliensis] Length = 249 Score = 66.6 bits (161), Expect = 1e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -1 Query: 359 GGLVIEFGQKVFDMSIKTRAKQMEKFLREPLNF 261 GGLV+EFGQKVFDMSIKTRAKQME+FLREP+NF Sbjct: 214 GGLVVEFGQKVFDMSIKTRAKQMERFLREPINF 246 >ref|XP_008787944.1| PREDICTED: ATP synthase subunit O, mitochondrial [Phoenix dactylifera] Length = 251 Score = 65.9 bits (159), Expect = 2e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -1 Query: 359 GGLVIEFGQKVFDMSIKTRAKQMEKFLREPLNF 261 GGLV+EFGQKVFDMSIKTRAKQMEKFLREP++F Sbjct: 215 GGLVVEFGQKVFDMSIKTRAKQMEKFLREPIDF 247 >gb|ONK81342.1| uncharacterized protein A4U43_C01F28000 [Asparagus officinalis] Length = 224 Score = 65.5 bits (158), Expect = 2e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 359 GGLVIEFGQKVFDMSIKTRAKQMEKFLREPLNF*K 255 GGLVIEFG KVFDMSIKTRAKQMEKFLR+P+NF K Sbjct: 189 GGLVIEFGDKVFDMSIKTRAKQMEKFLRDPINFDK 223 >ref|XP_020251640.1| LOW QUALITY PROTEIN: ATP synthase subunit O, mitochondrial [Asparagus officinalis] Length = 242 Score = 65.5 bits (158), Expect = 3e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 359 GGLVIEFGQKVFDMSIKTRAKQMEKFLREPLNF*K 255 GGLVIEFG KVFDMSIKTRAKQMEKFLR+P+NF K Sbjct: 207 GGLVIEFGDKVFDMSIKTRAKQMEKFLRDPINFDK 241 >ref|XP_010278998.1| PREDICTED: ATP synthase subunit O, mitochondrial-like [Nelumbo nucifera] Length = 243 Score = 65.5 bits (158), Expect = 3e-10 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -1 Query: 359 GGLVIEFGQKVFDMSIKTRAKQMEKFLREPLNF 261 GGLV+EFGQKVFDMSIKTRA+QME+FLREP+NF Sbjct: 208 GGLVVEFGQKVFDMSIKTRARQMERFLREPINF 240 >ref|XP_010257251.1| PREDICTED: ATP synthase subunit O, mitochondrial-like [Nelumbo nucifera] Length = 243 Score = 65.5 bits (158), Expect = 3e-10 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -1 Query: 359 GGLVIEFGQKVFDMSIKTRAKQMEKFLREPLNF 261 GGLV+EFGQKVFDMSIKTRA+QME+FLREP+NF Sbjct: 208 GGLVVEFGQKVFDMSIKTRARQMERFLREPINF 240 >ref|XP_022756780.1| ATP synthase subunit O, mitochondrial-like [Durio zibethinus] Length = 247 Score = 65.5 bits (158), Expect = 3e-10 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -1 Query: 359 GGLVIEFGQKVFDMSIKTRAKQMEKFLREPLNF 261 GGLV+EFGQKVFDMSIKTRA+QME+FLREP+NF Sbjct: 212 GGLVVEFGQKVFDMSIKTRARQMERFLREPINF 244 >ref|XP_023737122.1| ATP synthase subunit O, mitochondrial-like [Lactuca sativa] gb|PLY71250.1| hypothetical protein LSAT_1X107421 [Lactuca sativa] Length = 248 Score = 65.5 bits (158), Expect = 3e-10 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -1 Query: 359 GGLVIEFGQKVFDMSIKTRAKQMEKFLREPLNF 261 GGLV+EFGQKVFDMSIKTRAKQME+FLR+P+NF Sbjct: 214 GGLVVEFGQKVFDMSIKTRAKQMERFLRDPINF 246 >ref|XP_023737123.1| ATP synthase subunit O, mitochondrial-like [Lactuca sativa] gb|PLY71252.1| hypothetical protein LSAT_1X107400 [Lactuca sativa] Length = 250 Score = 65.5 bits (158), Expect = 3e-10 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -1 Query: 359 GGLVIEFGQKVFDMSIKTRAKQMEKFLREPLNF 261 GGLV+EFGQKVFDMSIKTRAKQME+FLR+P+NF Sbjct: 216 GGLVVEFGQKVFDMSIKTRAKQMERFLRDPINF 248 >ref|XP_010940031.1| PREDICTED: ATP synthase subunit O, mitochondrial [Elaeis guineensis] Length = 251 Score = 65.5 bits (158), Expect = 3e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -1 Query: 359 GGLVIEFGQKVFDMSIKTRAKQMEKFLREPLNF 261 GGLV+EFGQK+FDMSIKTRAKQMEKFLREPL+F Sbjct: 215 GGLVVEFGQKLFDMSIKTRAKQMEKFLREPLDF 247 >sp|P22778.1|ATPO_IPOBA RecName: Full=ATP synthase subunit O, mitochondrial; AltName: Full=Oligomycin sensitivity conferral protein; Short=OSCP; Flags: Precursor gb|AAA33388.1| F-1-ATPase delta subunit precursor (EC 3.6.1.3) [Ipomoea batatas] Length = 244 Score = 65.1 bits (157), Expect = 4e-10 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -1 Query: 359 GGLVIEFGQKVFDMSIKTRAKQMEKFLREPLNF 261 GGLV+EFGQKVFDMSI+TRA+QME+FLREPLNF Sbjct: 212 GGLVVEFGQKVFDMSIRTRARQMERFLREPLNF 244 >dbj|BAA77508.1| F1-ATP synthase delta subunit [Ipomoea batatas] Length = 244 Score = 65.1 bits (157), Expect = 4e-10 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -1 Query: 359 GGLVIEFGQKVFDMSIKTRAKQMEKFLREPLNF 261 GGLV+EFGQKVFDMSI+TRA+QME+FLREPLNF Sbjct: 212 GGLVVEFGQKVFDMSIRTRARQMERFLREPLNF 244 >ref|XP_009393603.1| PREDICTED: ATP synthase subunit O, mitochondrial [Musa acuminata subsp. malaccensis] Length = 241 Score = 64.7 bits (156), Expect = 5e-10 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -1 Query: 359 GGLVIEFGQKVFDMSIKTRAKQMEKFLREPLNF*KF 252 GGL++EF QKVFDMSIKTRAKQMEKFLREP+NF F Sbjct: 206 GGLMVEFDQKVFDMSIKTRAKQMEKFLREPINFDNF 241 >gb|KVI00681.1| hypothetical protein Ccrd_021069 [Cynara cardunculus var. scolymus] Length = 250 Score = 64.7 bits (156), Expect = 6e-10 Identities = 28/33 (84%), Positives = 33/33 (100%) Frame = -1 Query: 359 GGLVIEFGQKVFDMSIKTRAKQMEKFLREPLNF 261 GG+V+EFGQKVFDMSIKTRAKQME+FLR+P+NF Sbjct: 216 GGIVVEFGQKVFDMSIKTRAKQMERFLRDPINF 248 >ref|XP_022018132.1| ATP synthase subunit O, mitochondrial-like [Helianthus annuus] gb|OTF92679.1| putative ATP synthase subunit O [Helianthus annuus] Length = 247 Score = 64.3 bits (155), Expect = 8e-10 Identities = 28/33 (84%), Positives = 33/33 (100%) Frame = -1 Query: 359 GGLVIEFGQKVFDMSIKTRAKQMEKFLREPLNF 261 GGLV+EFGQKVFDMSIKTRA+QME+FLR+P+NF Sbjct: 213 GGLVVEFGQKVFDMSIKTRARQMERFLRDPINF 245