BLASTX nr result
ID: Ophiopogon27_contig00007748
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00007748 (888 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020276787.1| mannose-specific lectin-like [Asparagus offi... 74 2e-12 ref|XP_020276430.1| mannose-specific lectin-like [Asparagus offi... 74 2e-12 gb|ONK61355.1| uncharacterized protein A4U43_C08F29020 [Asparagu... 69 7e-10 >ref|XP_020276787.1| mannose-specific lectin-like [Asparagus officinalis] gb|ONK62136.1| uncharacterized protein A4U43_C07F720 [Asparagus officinalis] Length = 150 Score = 73.6 bits (179), Expect = 2e-12 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +3 Query: 3 GEVAVKYIGGAPLWTSGATGPAKSDYVLALRPDGNAAVYGPSIW 134 GE+ VKY+GG PLW SG TGP SDYVL +RP+G AVYGPS+W Sbjct: 80 GELRVKYLGGVPLWGSGVTGPPNSDYVLTIRPEGKLAVYGPSLW 123 >ref|XP_020276430.1| mannose-specific lectin-like [Asparagus officinalis] gb|ONK62134.1| uncharacterized protein A4U43_C07F700 [Asparagus officinalis] Length = 151 Score = 73.6 bits (179), Expect = 2e-12 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +3 Query: 3 GEVAVKYIGGAPLWTSGATGPAKSDYVLALRPDGNAAVYGPSIW 134 GE+ VKY+GG PLW SG TGP SDYVL +RP+G AVYGPS+W Sbjct: 80 GELRVKYLGGVPLWGSGVTGPPNSDYVLTIRPEGKLAVYGPSLW 123 >gb|ONK61355.1| uncharacterized protein A4U43_C08F29020 [Asparagus officinalis] Length = 286 Score = 69.3 bits (168), Expect = 7e-10 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = +3 Query: 3 GEVAVKYIGGAPLWTSGATGPAKSDYVLALRPDGNAAVYGPSIW 134 GE+ VKY+GG LW +G GP KSDYVL +RP+G A+YGPS+W Sbjct: 220 GELMVKYLGGVDLWRTGVAGPRKSDYVLTIRPEGKLAIYGPSLW 263