BLASTX nr result
ID: Ophiopogon27_contig00007733
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00007733 (480 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_018686429.1| PREDICTED: ras GTPase-activating protein-bin... 56 3e-06 ref|XP_020089579.1| putative G3BP-like protein [Ananas comosus] 56 5e-06 >ref|XP_018686429.1| PREDICTED: ras GTPase-activating protein-binding protein 1-like [Musa acuminata subsp. malaccensis] Length = 442 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 3 IEASPVTIGGRQVFVEEKRPTTTRASSRGRFTP 101 IEASPVTIGGRQV+VEEKR T++R S+RGRF P Sbjct: 356 IEASPVTIGGRQVYVEEKRATSSRVSNRGRFPP 388 >ref|XP_020089579.1| putative G3BP-like protein [Ananas comosus] Length = 491 Score = 55.8 bits (133), Expect = 5e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 3 IEASPVTIGGRQVFVEEKRPTTTRASSRGRFT 98 IEASPV IGGRQ +VEEKRPT +R SSRGRFT Sbjct: 374 IEASPVMIGGRQAYVEEKRPTASRVSSRGRFT 405