BLASTX nr result
ID: Ophiopogon27_contig00007013
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00007013 (403 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020089459.1| 50S ribosomal protein L21, chloroplastic [An... 86 7e-18 gb|OAY83382.1| 50S ribosomal protein L21, chloroplastic [Ananas ... 86 8e-18 ref|XP_020244266.1| 50S ribosomal protein L21, chloroplastic [As... 82 1e-17 gb|PKA59036.1| 50S ribosomal protein L21, chloroplastic [Apostas... 85 1e-17 ref|XP_009413821.1| PREDICTED: 50S ribosomal protein L21, chloro... 85 1e-17 ref|XP_020700788.1| 50S ribosomal protein L21, chloroplastic-lik... 82 2e-16 ref|XP_010915746.1| PREDICTED: 50S ribosomal protein L21, chloro... 80 1e-15 ref|XP_008795009.1| PREDICTED: 50S ribosomal protein L21, chloro... 80 1e-15 gb|KZN08516.1| hypothetical protein DCAR_001046 [Daucus carota s... 74 2e-14 pdb|5H1S|T Chain T, Structure Of The Large Subunit Of The Chloro... 75 8e-14 ref|XP_023872025.1| 50S ribosomal protein L21, chloroplastic [Qu... 75 8e-14 dbj|BAS77977.1| Os02g0259600, partial [Oryza sativa Japonica Group] 71 1e-13 gb|OMO68704.1| Ribosomal protein L21 [Corchorus capsularis] 75 1e-13 ref|XP_006434608.1| 50S ribosomal protein L21, chloroplastic iso... 74 1e-13 gb|PPR95032.1| hypothetical protein GOBAR_AA25629 [Gossypium bar... 74 2e-13 ref|XP_020574961.1| 50S ribosomal protein L21, chloroplastic [Ph... 74 2e-13 gb|KNA20045.1| hypothetical protein SOVF_056040 [Spinacia oleracea] 75 2e-13 ref|XP_021864087.1| 50S ribosomal protein L21, chloroplastic [Sp... 75 2e-13 pdb|3BBO|T Chain T, Homology Model For The Spinach Chloroplast 5... 75 2e-13 ref|XP_018821060.1| PREDICTED: 50S ribosomal protein L21, chloro... 74 2e-13 >ref|XP_020089459.1| 50S ribosomal protein L21, chloroplastic [Ananas comosus] Length = 215 Score = 85.5 bits (210), Expect = 7e-18 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -1 Query: 403 YKKKKNYRRNIGHRQPNTRIRITGITGYEDFPAETMPEEIPA 278 YKKKKNYRR IGHRQPNTRI+ITGITGY+DFPAETMPE IPA Sbjct: 174 YKKKKNYRRTIGHRQPNTRIKITGITGYQDFPAETMPETIPA 215 >gb|OAY83382.1| 50S ribosomal protein L21, chloroplastic [Ananas comosus] Length = 216 Score = 85.5 bits (210), Expect = 8e-18 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -1 Query: 403 YKKKKNYRRNIGHRQPNTRIRITGITGYEDFPAETMPEEIPA 278 YKKKKNYRR IGHRQPNTRI+ITGITGY+DFPAETMPE IPA Sbjct: 175 YKKKKNYRRTIGHRQPNTRIKITGITGYQDFPAETMPETIPA 216 >ref|XP_020244266.1| 50S ribosomal protein L21, chloroplastic [Asparagus officinalis] gb|ONK60443.1| uncharacterized protein A4U43_C08F18530 [Asparagus officinalis] Length = 114 Score = 82.4 bits (202), Expect = 1e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -1 Query: 403 YKKKKNYRRNIGHRQPNTRIRITGITGYEDFPAETMPEEIPA 278 YKKKKNYRRNIGHRQPNTRIRITGI+GYEDFPAETM E+I A Sbjct: 73 YKKKKNYRRNIGHRQPNTRIRITGISGYEDFPAETMSEKILA 114 >gb|PKA59036.1| 50S ribosomal protein L21, chloroplastic [Apostasia shenzhenica] Length = 222 Score = 85.1 bits (209), Expect = 1e-17 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -1 Query: 403 YKKKKNYRRNIGHRQPNTRIRITGITGYEDFPAETMPEEIPA 278 YK+KKNYRRNIGHRQPNTRIRI GITGYED+PAETMPE +PA Sbjct: 181 YKRKKNYRRNIGHRQPNTRIRIMGITGYEDYPAETMPETVPA 222 >ref|XP_009413821.1| PREDICTED: 50S ribosomal protein L21, chloroplastic [Musa acuminata subsp. malaccensis] Length = 224 Score = 85.1 bits (209), Expect = 1e-17 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = -1 Query: 403 YKKKKNYRRNIGHRQPNTRIRITGITGYEDFPAETMPEEIPA 278 YKKKKNYRRNIGHRQP TRIRITGITGY+DFPAETMPE PA Sbjct: 183 YKKKKNYRRNIGHRQPRTRIRITGITGYQDFPAETMPETFPA 224 >ref|XP_020700788.1| 50S ribosomal protein L21, chloroplastic-like [Dendrobium catenatum] Length = 228 Score = 82.0 bits (201), Expect = 2e-16 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -1 Query: 403 YKKKKNYRRNIGHRQPNTRIRITGITGYEDFPAETMPE 290 YKKKKNYRRNIGHRQPNTRIRITGI+GYEDFPA+TMPE Sbjct: 184 YKKKKNYRRNIGHRQPNTRIRITGISGYEDFPADTMPE 221 >ref|XP_010915746.1| PREDICTED: 50S ribosomal protein L21, chloroplastic [Elaeis guineensis] Length = 224 Score = 79.7 bits (195), Expect = 1e-15 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = -1 Query: 403 YKKKKNYRRNIGHRQPNTRIRITGITGYEDFPAETMPEEIPA 278 +KKKKNYRR IGHRQP TRIRITGITGYEDFP ET+PE +PA Sbjct: 183 FKKKKNYRRTIGHRQPRTRIRITGITGYEDFPFETLPEMVPA 224 >ref|XP_008795009.1| PREDICTED: 50S ribosomal protein L21, chloroplastic [Phoenix dactylifera] Length = 224 Score = 79.7 bits (195), Expect = 1e-15 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = -1 Query: 403 YKKKKNYRRNIGHRQPNTRIRITGITGYEDFPAETMPEEIPA 278 +KKKKNYRR IGHRQP TRIRITGITGYEDFP ET+PE +PA Sbjct: 183 FKKKKNYRRTIGHRQPRTRIRITGITGYEDFPFETLPEMVPA 224 >gb|KZN08516.1| hypothetical protein DCAR_001046 [Daucus carota subsp. sativus] Length = 87 Score = 73.6 bits (179), Expect = 2e-14 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -1 Query: 403 YKKKKNYRRNIGHRQPNTRIRITGITGYEDFPAETMP 293 YKKKKNYRRNIGHRQPNTRIRI GITGYED PA T+P Sbjct: 51 YKKKKNYRRNIGHRQPNTRIRIMGITGYEDSPAVTLP 87 >pdb|5H1S|T Chain T, Structure Of The Large Subunit Of The Chloro-ribosome pdb|5X8T|S Chain S, Structure Of The 50s Large Subunit Of Chloroplast Ribosome From Spinach Length = 201 Score = 74.7 bits (182), Expect = 8e-14 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -1 Query: 403 YKKKKNYRRNIGHRQPNTRIRITGITGYEDFPAETMPEEIPA 278 YKKKKNYRRNIGHRQP TRI+ITGITGYED+PA T+ E+ A Sbjct: 145 YKKKKNYRRNIGHRQPITRIKITGITGYEDYPASTLEAEVEA 186 >ref|XP_023872025.1| 50S ribosomal protein L21, chloroplastic [Quercus suber] Length = 223 Score = 75.1 bits (183), Expect = 8e-14 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -1 Query: 403 YKKKKNYRRNIGHRQPNTRIRITGITGYEDFPAETM 296 YKKKKNYRRNIGHRQPNTRIRITGITGYED+PA T+ Sbjct: 186 YKKKKNYRRNIGHRQPNTRIRITGITGYEDYPAVTL 221 >dbj|BAS77977.1| Os02g0259600, partial [Oryza sativa Japonica Group] Length = 77 Score = 71.2 bits (173), Expect = 1e-13 Identities = 30/42 (71%), Positives = 37/42 (88%) Frame = -1 Query: 403 YKKKKNYRRNIGHRQPNTRIRITGITGYEDFPAETMPEEIPA 278 YKKKK Y+R +GHRQPNTR+RITGI+GYEDFPA+ + E +PA Sbjct: 36 YKKKKKYQRKLGHRQPNTRLRITGISGYEDFPADPILEYVPA 77 >gb|OMO68704.1| Ribosomal protein L21 [Corchorus capsularis] Length = 216 Score = 74.7 bits (182), Expect = 1e-13 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -1 Query: 403 YKKKKNYRRNIGHRQPNTRIRITGITGYEDFPAETM 296 YKKKKNYRRNIGHRQPNTRIRITGITGY+D+PA T+ Sbjct: 179 YKKKKNYRRNIGHRQPNTRIRITGITGYQDYPASTL 214 >ref|XP_006434608.1| 50S ribosomal protein L21, chloroplastic isoform X2 [Citrus clementina] gb|ESR47848.1| hypothetical protein CICLE_v10002401mg [Citrus clementina] Length = 195 Score = 73.9 bits (180), Expect = 1e-13 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -1 Query: 403 YKKKKNYRRNIGHRQPNTRIRITGITGYEDFPAETM 296 YKKKKNYRRNIGHRQPNTRIRITGITGY+D+PA T+ Sbjct: 153 YKKKKNYRRNIGHRQPNTRIRITGITGYQDYPAVTL 188 >gb|PPR95032.1| hypothetical protein GOBAR_AA25629 [Gossypium barbadense] Length = 203 Score = 73.9 bits (180), Expect = 2e-13 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -1 Query: 403 YKKKKNYRRNIGHRQPNTRIRITGITGYEDFPAETM 296 YKKKKNYRRNIGHRQPNTRIRITGITGY+D+PA T+ Sbjct: 166 YKKKKNYRRNIGHRQPNTRIRITGITGYQDYPAVTL 201 >ref|XP_020574961.1| 50S ribosomal protein L21, chloroplastic [Phalaenopsis equestris] Length = 226 Score = 74.3 bits (181), Expect = 2e-13 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = -1 Query: 403 YKKKKNYRRNIGHRQPNTRIRITGITGYEDFPAETMPE 290 YKKKKNYRRNIGHRQPNTRIRI GI+GYE +PA+T+PE Sbjct: 183 YKKKKNYRRNIGHRQPNTRIRIIGISGYEAYPADTLPE 220 >gb|KNA20045.1| hypothetical protein SOVF_056040 [Spinacia oleracea] Length = 254 Score = 74.7 bits (182), Expect = 2e-13 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -1 Query: 403 YKKKKNYRRNIGHRQPNTRIRITGITGYEDFPAETMPEEIPA 278 YKKKKNYRRNIGHRQP TRI+ITGITGYED+PA T+ E+ A Sbjct: 200 YKKKKNYRRNIGHRQPITRIKITGITGYEDYPASTLEAEVEA 241 >ref|XP_021864087.1| 50S ribosomal protein L21, chloroplastic [Spinacia oleracea] sp|P24613.1|RK21_SPIOL RecName: Full=50S ribosomal protein L21, chloroplastic; AltName: Full=CL21; AltName: Full=CS-L7; AltName: Full=Chloroplastic large ribosomal subunit protein bL21c; Flags: Precursor pdb|5MLC|T Chain T, Cryo-em Structure Of The Spinach Chloroplast Ribosome Reveals The Location Of Plastid-specific Ribosomal Proteins And Extensions pdb|5MMI|S Chain S, Structure Of The Large Subunit Of The Chloroplast Ribosome pdb|5MMM|S Chain S, Structure of the 70S chloroplast ribosome emb|CAA40019.1| L21 r-protein [Spinacia oleracea] gb|AAA34041.1| ribosomal protein L21 [Spinacia oleracea] gb|AAA74715.1| ribosomal protein L21 [Spinacia oleracea] Length = 256 Score = 74.7 bits (182), Expect = 2e-13 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -1 Query: 403 YKKKKNYRRNIGHRQPNTRIRITGITGYEDFPAETMPEEIPA 278 YKKKKNYRRNIGHRQP TRI+ITGITGYED+PA T+ E+ A Sbjct: 200 YKKKKNYRRNIGHRQPITRIKITGITGYEDYPASTLEAEVEA 241 >pdb|3BBO|T Chain T, Homology Model For The Spinach Chloroplast 50s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome Length = 257 Score = 74.7 bits (182), Expect = 2e-13 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -1 Query: 403 YKKKKNYRRNIGHRQPNTRIRITGITGYEDFPAETMPEEIPA 278 YKKKKNYRRNIGHRQP TRI+ITGITGYED+PA T+ E+ A Sbjct: 201 YKKKKNYRRNIGHRQPITRIKITGITGYEDYPASTLEAEVEA 242 >ref|XP_018821060.1| PREDICTED: 50S ribosomal protein L21, chloroplastic-like [Juglans regia] Length = 214 Score = 73.9 bits (180), Expect = 2e-13 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -1 Query: 403 YKKKKNYRRNIGHRQPNTRIRITGITGYEDFPAETM 296 YKKKKNYRRNIGHRQPNTRIRITGITGY+D+PA T+ Sbjct: 177 YKKKKNYRRNIGHRQPNTRIRITGITGYQDYPAVTL 212