BLASTX nr result
ID: Ophiopogon27_contig00007002
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00007002 (551 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020257070.1| U4/U6 small nuclear ribonucleoprotein Prp31 ... 57 4e-06 gb|ONK75217.1| uncharacterized protein A4U43_C03F14570 [Asparagu... 57 4e-06 >ref|XP_020257070.1| U4/U6 small nuclear ribonucleoprotein Prp31 homolog isoform X1 [Asparagus officinalis] ref|XP_020257071.1| U4/U6 small nuclear ribonucleoprotein Prp31 homolog isoform X2 [Asparagus officinalis] Length = 487 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -2 Query: 550 ELSNPQANGNALGRGTQSMYFSEVDTFSKIRK 455 ELSNPQA+GNALG GTQS YFSEV TFSKIR+ Sbjct: 455 ELSNPQAHGNALGGGTQSTYFSEVGTFSKIRR 486 >gb|ONK75217.1| uncharacterized protein A4U43_C03F14570 [Asparagus officinalis] Length = 488 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -2 Query: 550 ELSNPQANGNALGRGTQSMYFSEVDTFSKIRK 455 ELSNPQA+GNALG GTQS YFSEV TFSKIR+ Sbjct: 456 ELSNPQAHGNALGGGTQSTYFSEVGTFSKIRR 487