BLASTX nr result
ID: Ophiopogon27_contig00006441
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00006441 (356 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020244315.1| uncharacterized protein LOC109822512 [Aspara... 57 8e-07 gb|ONK60176.1| uncharacterized protein A4U43_C08F15200 [Asparagu... 57 8e-07 >ref|XP_020244315.1| uncharacterized protein LOC109822512 [Asparagus officinalis] Length = 850 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/43 (60%), Positives = 28/43 (65%) Frame = +3 Query: 228 EERAYGRSGIWLGSTFPLWARXXXXXXXXXXXXIGTRGSNVIS 356 EERAYGRSG+WL S FP WAR IGTRG+NVIS Sbjct: 3 EERAYGRSGVWLASAFPFWARLLLVGFQIMLLIIGTRGNNVIS 45 >gb|ONK60176.1| uncharacterized protein A4U43_C08F15200 [Asparagus officinalis] Length = 933 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/43 (60%), Positives = 28/43 (65%) Frame = +3 Query: 228 EERAYGRSGIWLGSTFPLWARXXXXXXXXXXXXIGTRGSNVIS 356 EERAYGRSG+WL S FP WAR IGTRG+NVIS Sbjct: 3 EERAYGRSGVWLASAFPFWARLLLVGFQIMLLIIGTRGNNVIS 45