BLASTX nr result
ID: Ophiopogon27_contig00006413
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00006413 (361 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012436849.1| PREDICTED: uncharacterized protein LOC105763... 81 4e-18 ref|XP_010233766.1| PREDICTED: uncharacterized protein LOC104583... 80 8e-18 ref|XP_015576248.1| PREDICTED: uncharacterized protein LOC107261... 80 1e-17 gb|OAY57449.1| hypothetical protein MANES_02G097800 [Manihot esc... 79 2e-17 gb|PIA52775.1| hypothetical protein AQUCO_01000560v1 [Aquilegia ... 79 3e-17 ref|XP_008241732.2| PREDICTED: uncharacterized protein LOC103340... 79 3e-17 ref|XP_011028507.1| PREDICTED: uncharacterized protein LOC105128... 78 7e-17 ref|XP_008784952.1| PREDICTED: uncharacterized protein LOC103703... 78 7e-17 ref|XP_016696981.1| PREDICTED: uncharacterized protein LOC107913... 77 1e-16 gb|PIN15758.1| hypothetical protein CDL12_11567 [Handroanthus im... 77 1e-16 ref|XP_003544337.1| PREDICTED: uncharacterized protein LOC100799... 77 1e-16 ref|XP_009793690.1| PREDICTED: uncharacterized protein LOC104240... 77 1e-16 ref|XP_017429722.1| PREDICTED: uncharacterized protein LOC108337... 77 2e-16 ref|XP_016682625.1| PREDICTED: uncharacterized protein LOC107901... 77 2e-16 dbj|BAT82830.1| hypothetical protein VIGAN_03289900 [Vigna angul... 79 2e-16 ref|XP_016899222.1| PREDICTED: uncharacterized protein LOC107990... 76 3e-16 ref|XP_006473551.1| PREDICTED: uncharacterized protein LOC102624... 76 4e-16 ref|XP_016479999.1| PREDICTED: uncharacterized protein LOC107801... 76 4e-16 gb|PIN23011.1| hypothetical protein CDL12_04270 [Handroanthus im... 75 5e-16 ref|XP_016900032.1| PREDICTED: uncharacterized protein LOC107990... 75 5e-16 >ref|XP_012436849.1| PREDICTED: uncharacterized protein LOC105763252 [Gossypium raimondii] ref|XP_016723474.1| PREDICTED: uncharacterized protein LOC107935386 [Gossypium hirsutum] ref|XP_016735458.1| PREDICTED: uncharacterized protein LOC107945825 [Gossypium hirsutum] ref|XP_017637265.1| PREDICTED: uncharacterized protein LOC108479277 [Gossypium arboreum] ref|XP_017970110.1| PREDICTED: uncharacterized protein LOC108660570 [Theobroma cacao] Length = 41 Score = 80.9 bits (198), Expect = 4e-18 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = +3 Query: 204 MSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVF 323 MSP+LSEILLSGFMINSTLRRR+HLVQSFSVVFLYWFYVF Sbjct: 1 MSPVLSEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVF 40 >ref|XP_010233766.1| PREDICTED: uncharacterized protein LOC104583416 [Brachypodium distachyon] ref|XP_015622691.1| PREDICTED: uncharacterized protein LOC107279891 [Oryza sativa Japonica Group] ref|XP_015890019.1| PREDICTED: uncharacterized protein LOC107424684 [Ziziphus jujuba] gb|KQJ93156.1| hypothetical protein BRADI_3g02990v3 [Brachypodium distachyon] gb|KXG29403.1| hypothetical protein SORBI_3004G031200 [Sorghum bicolor] gb|OEL36113.1| hypothetical protein BAE44_0002863 [Dichanthelium oligosanthes] gb|PAN03873.1| hypothetical protein PAHAL_A00206 [Panicum hallii] Length = 41 Score = 80.1 bits (196), Expect = 8e-18 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +3 Query: 204 MSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVF 323 MSP++SEILLSGFMINSTLRRR+HLVQSFSVVFLYWFYVF Sbjct: 1 MSPVISEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVF 40 >ref|XP_015576248.1| PREDICTED: uncharacterized protein LOC107261451 [Ricinus communis] Length = 41 Score = 79.7 bits (195), Expect = 1e-17 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +3 Query: 204 MSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVF 323 MSP++SEILLSGFMINSTLRRR+HLVQSFSVVFLYWFYVF Sbjct: 1 MSPVVSEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVF 40 >gb|OAY57449.1| hypothetical protein MANES_02G097800 [Manihot esculenta] Length = 41 Score = 79.0 bits (193), Expect = 2e-17 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +3 Query: 204 MSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVF 323 MSP+L EILLSGFMINSTLRRR+HLVQSFSVVFLYWFYVF Sbjct: 1 MSPVLCEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVF 40 >gb|PIA52775.1| hypothetical protein AQUCO_01000560v1 [Aquilegia coerulea] Length = 41 Score = 78.6 bits (192), Expect = 3e-17 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +3 Query: 204 MSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVF 323 MSP+LSEILL GFMINSTLRRR+HLVQSFSVVFLYWFYVF Sbjct: 1 MSPVLSEILLLGFMINSTLRRRTHLVQSFSVVFLYWFYVF 40 >ref|XP_008241732.2| PREDICTED: uncharacterized protein LOC103340134 [Prunus mume] gb|ONH96935.1| hypothetical protein PRUPE_7G160500 [Prunus persica] Length = 41 Score = 78.6 bits (192), Expect = 3e-17 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = +3 Query: 204 MSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVF 323 MSP+LSEILLSGFM+NSTLRRR+HLVQSFSV FLYWFYVF Sbjct: 1 MSPVLSEILLSGFMVNSTLRRRTHLVQSFSVCFLYWFYVF 40 >ref|XP_011028507.1| PREDICTED: uncharacterized protein LOC105128494 [Populus euphratica] Length = 41 Score = 77.8 bits (190), Expect = 7e-17 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = +3 Query: 204 MSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVF 323 M+P+L EILLSGFMINSTLRRR+HLVQSFSVVFLYWFYVF Sbjct: 1 MTPVLCEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVF 40 >ref|XP_008784952.1| PREDICTED: uncharacterized protein LOC103703760 [Phoenix dactylifera] ref|XP_008795970.1| PREDICTED: uncharacterized protein LOC103711555 [Phoenix dactylifera] Length = 41 Score = 77.8 bits (190), Expect = 7e-17 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +3 Query: 204 MSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVF 323 MSPILSEILLSGFMI+S+LRRR+HLVQSFSVVFLYWFYVF Sbjct: 1 MSPILSEILLSGFMISSSLRRRTHLVQSFSVVFLYWFYVF 40 >ref|XP_016696981.1| PREDICTED: uncharacterized protein LOC107913053 [Gossypium hirsutum] Length = 41 Score = 77.4 bits (189), Expect = 1e-16 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = +3 Query: 204 MSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVF 323 MSP++SEILLSG MINSTLRRR+HLVQSFSVVFLYWFYVF Sbjct: 1 MSPVVSEILLSGLMINSTLRRRTHLVQSFSVVFLYWFYVF 40 >gb|PIN15758.1| hypothetical protein CDL12_11567 [Handroanthus impetiginosus] Length = 42 Score = 77.4 bits (189), Expect = 1e-16 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +3 Query: 201 LMSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVF 323 +MSP+LSEILLSGF NSTLRRRSHLVQSFSVVFLYWFYVF Sbjct: 1 MMSPVLSEILLSGFTGNSTLRRRSHLVQSFSVVFLYWFYVF 41 >ref|XP_003544337.1| PREDICTED: uncharacterized protein LOC100799960 [Glycine max] ref|XP_003550394.1| PREDICTED: uncharacterized protein LOC100799844 [Glycine max] ref|XP_007160725.1| hypothetical protein PHAVU_001G011900g [Phaseolus vulgaris] ref|XP_015576833.1| PREDICTED: uncharacterized protein LOC107261510 [Ricinus communis] gb|ESW32719.1| hypothetical protein PHAVU_001G011900g [Phaseolus vulgaris] gb|KMT20717.1| hypothetical protein BVRB_1g006920 [Beta vulgaris subsp. vulgaris] gb|KRH15150.1| hypothetical protein GLYMA_14G071500 [Glycine max] gb|OAY21340.1| hypothetical protein MANES_S096000 [Manihot esculenta] gb|OAY21592.1| hypothetical protein MANES_S074500 [Manihot esculenta] Length = 41 Score = 77.0 bits (188), Expect = 1e-16 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = +3 Query: 204 MSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVF 323 MSP+LSEIL SGFMINS+LRRR+HLVQSFSVVFLYWFYVF Sbjct: 1 MSPVLSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFYVF 40 >ref|XP_009793690.1| PREDICTED: uncharacterized protein LOC104240532 [Nicotiana sylvestris] ref|XP_016501595.1| PREDICTED: uncharacterized protein LOC107819919 [Nicotiana tabacum] Length = 45 Score = 77.0 bits (188), Expect = 1e-16 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = +3 Query: 195 F*LMSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVF 323 F +MSP++SE+LLSGF INSTL RR+HLVQSFSVVFLYWFYVF Sbjct: 2 FGIMSPVISEVLLSGFTINSTLHRRTHLVQSFSVVFLYWFYVF 44 >ref|XP_017429722.1| PREDICTED: uncharacterized protein LOC108337663 [Vigna angularis] Length = 41 Score = 76.6 bits (187), Expect = 2e-16 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = +3 Query: 204 MSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVF 323 MSP+LSEIL SGFMINS+LRRR+HLVQSFSV+FLYWFYVF Sbjct: 1 MSPVLSEILRSGFMINSSLRRRTHLVQSFSVIFLYWFYVF 40 >ref|XP_016682625.1| PREDICTED: uncharacterized protein LOC107901221 [Gossypium hirsutum] ref|XP_017629680.1| PREDICTED: uncharacterized protein LOC108472643 [Gossypium arboreum] Length = 41 Score = 76.6 bits (187), Expect = 2e-16 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +3 Query: 204 MSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVF 323 MSP+L EILLSG MINSTLRRR+HLVQSFSVVFLYWFYVF Sbjct: 1 MSPVLCEILLSGLMINSTLRRRTHLVQSFSVVFLYWFYVF 40 >dbj|BAT82830.1| hypothetical protein VIGAN_03289900 [Vigna angularis var. angularis] Length = 124 Score = 79.0 bits (193), Expect = 2e-16 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = +3 Query: 195 F*LMSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVF 323 F LMSP+LSEIL SGFMINS+LRRR+HLVQSFSV+FLYWFYVF Sbjct: 81 FTLMSPVLSEILRSGFMINSSLRRRTHLVQSFSVIFLYWFYVF 123 >ref|XP_016899222.1| PREDICTED: uncharacterized protein LOC107990447 [Cucumis melo] Length = 41 Score = 76.3 bits (186), Expect = 3e-16 Identities = 33/40 (82%), Positives = 40/40 (100%) Frame = +3 Query: 204 MSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVF 323 MSP+++E+LLSGF++NSTLRRR+HLVQSFSVVFLYWFYVF Sbjct: 1 MSPVVTEVLLSGFIVNSTLRRRTHLVQSFSVVFLYWFYVF 40 >ref|XP_006473551.1| PREDICTED: uncharacterized protein LOC102624295 [Citrus sinensis] ref|XP_016748736.1| PREDICTED: uncharacterized protein LOC107957695 [Gossypium hirsutum] ref|XP_016749064.1| PREDICTED: uncharacterized protein LOC107957944 [Gossypium hirsutum] ref|XP_016687605.1| PREDICTED: uncharacterized protein LOC107905459 [Gossypium hirsutum] ref|XP_017621252.1| PREDICTED: uncharacterized protein LOC108465439 [Gossypium arboreum] ref|XP_017608544.1| PREDICTED: uncharacterized protein LOC108454556 [Gossypium arboreum] ref|XP_017981825.1| PREDICTED: uncharacterized protein LOC18591442 [Theobroma cacao] gb|EOY14848.1| Peptide upstream open reading frame 5 [Theobroma cacao] gb|PNT47556.1| hypothetical protein POPTR_002G032000v3 [Populus trichocarpa] Length = 41 Score = 75.9 bits (185), Expect = 4e-16 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = +3 Query: 204 MSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVF 323 MSP++SEIL SGFMINS+LRRR+HLVQSFSVVFLYWFYVF Sbjct: 1 MSPVVSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFYVF 40 >ref|XP_016479999.1| PREDICTED: uncharacterized protein LOC107801228 [Nicotiana tabacum] Length = 45 Score = 75.9 bits (185), Expect = 4e-16 Identities = 34/43 (79%), Positives = 40/43 (93%) Frame = +3 Query: 195 F*LMSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVF 323 F +MSP++SE+LLSGF +NSTL RR+HLVQSFSVVFLYWFYVF Sbjct: 2 FEIMSPVISEVLLSGFTMNSTLHRRTHLVQSFSVVFLYWFYVF 44 >gb|PIN23011.1| hypothetical protein CDL12_04270 [Handroanthus impetiginosus] Length = 41 Score = 75.5 bits (184), Expect = 5e-16 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = +3 Query: 204 MSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVF 323 MSP+LSEIL SGF+INS+LRRR+HLVQSFSVVFLYWFYVF Sbjct: 1 MSPVLSEILRSGFIINSSLRRRTHLVQSFSVVFLYWFYVF 40 >ref|XP_016900032.1| PREDICTED: uncharacterized protein LOC107990722 [Cucumis melo] Length = 41 Score = 75.5 bits (184), Expect = 5e-16 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = +3 Query: 204 MSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVF 323 MSPILSEIL SGFMI+S+LRRR+HLVQSFSVVFLYWFYVF Sbjct: 1 MSPILSEILRSGFMIDSSLRRRTHLVQSFSVVFLYWFYVF 40