BLASTX nr result
ID: Ophiopogon27_contig00006317
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00006317 (411 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK73485.1| uncharacterized protein A4U43_C04F32060 [Asparagu... 58 3e-07 >gb|ONK73485.1| uncharacterized protein A4U43_C04F32060 [Asparagus officinalis] Length = 284 Score = 58.2 bits (139), Expect = 3e-07 Identities = 31/49 (63%), Positives = 33/49 (67%) Frame = -2 Query: 389 GRRSHGIGGARRTYLSGSRFYCRPGREYVDEEAEDYLVTMSSKYRIFDR 243 GRRS IGG R Y S S Y PGR YVD+ +E YLV MSSKY IFDR Sbjct: 198 GRRSGVIGGRRSDYKSESWKYFHPGRGYVDKASEYYLVKMSSKYNIFDR 246