BLASTX nr result
ID: Ophiopogon27_contig00006208
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00006208 (496 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020253024.1| 60S ribosomal protein L38-like [Asparagus of... 69 1e-12 ref|XP_020245980.1| 60S ribosomal protein L38 [Asparagus officin... 68 3e-12 ref|XP_015875766.1| PREDICTED: 60S ribosomal protein L38 [Ziziph... 67 8e-12 ref|XP_012085801.1| 60S ribosomal protein L38 [Jatropha curcas] ... 67 8e-12 ref|XP_004302190.1| PREDICTED: 60S ribosomal protein L38 [Fragar... 67 8e-12 ref|XP_022001977.1| 60S ribosomal protein L38 [Helianthus annuus] 66 2e-11 ref|XP_021969932.1| 60S ribosomal protein L38-like [Helianthus a... 66 2e-11 ref|XP_011007402.1| PREDICTED: 60S ribosomal protein L38-like [P... 66 2e-11 ref|XP_004289816.1| PREDICTED: 60S ribosomal protein L38-like [F... 66 2e-11 gb|AEJ20976.1| 60S ribosomal protein L38A [Caragana jubata] 66 2e-11 gb|KDO45681.1| hypothetical protein CISIN_1g0352561mg, partial [... 65 3e-11 ref|XP_024186514.1| 60S ribosomal protein L38 [Rosa chinensis] >... 65 3e-11 ref|XP_021774892.1| 60S ribosomal protein L38-like isoform X2 [C... 65 3e-11 ref|WP_071414624.1| hypothetical protein [Acinetobacter baumanni... 65 3e-11 ref|XP_008793782.1| PREDICTED: 60S ribosomal protein L38 [Phoeni... 65 3e-11 ref|XP_006428680.1| 60S ribosomal protein L38 [Citrus clementina... 65 3e-11 ref|XP_007207316.1| 60S ribosomal protein L38 [Prunus persica] >... 65 3e-11 ref|XP_003631881.1| PREDICTED: 60S ribosomal protein L38 [Vitis ... 65 3e-11 ref|XP_021774891.1| 60S ribosomal protein L38-like isoform X1 [C... 65 3e-11 ref|XP_022946384.1| 60S ribosomal protein L38 isoform X1 [Cucurb... 65 4e-11 >ref|XP_020253024.1| 60S ribosomal protein L38-like [Asparagus officinalis] Length = 69 Score = 69.3 bits (168), Expect = 1e-12 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -3 Query: 494 CSKYLYTLCVHDSEKADKLKQSLPPGLTVQDL 399 CSKYLYTLCVHD+EKADKLKQSLPPGLTVQDL Sbjct: 38 CSKYLYTLCVHDAEKADKLKQSLPPGLTVQDL 69 >ref|XP_020245980.1| 60S ribosomal protein L38 [Asparagus officinalis] Length = 69 Score = 68.2 bits (165), Expect = 3e-12 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -3 Query: 494 CSKYLYTLCVHDSEKADKLKQSLPPGLTVQDL 399 CS+YLYTLCVHD+EKADKLKQSLPPGLTVQDL Sbjct: 38 CSRYLYTLCVHDAEKADKLKQSLPPGLTVQDL 69 >ref|XP_015875766.1| PREDICTED: 60S ribosomal protein L38 [Ziziphus jujuba] Length = 69 Score = 67.0 bits (162), Expect = 8e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -3 Query: 494 CSKYLYTLCVHDSEKADKLKQSLPPGLTVQDL 399 CSKYLYTLCV DSEKADKLKQSLPPGLTVQDL Sbjct: 38 CSKYLYTLCVFDSEKADKLKQSLPPGLTVQDL 69 >ref|XP_012085801.1| 60S ribosomal protein L38 [Jatropha curcas] gb|KDP26900.1| hypothetical protein JCGZ_18058 [Jatropha curcas] gb|PIA29694.1| hypothetical protein AQUCO_05800065v1 [Aquilegia coerulea] Length = 69 Score = 67.0 bits (162), Expect = 8e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -3 Query: 494 CSKYLYTLCVHDSEKADKLKQSLPPGLTVQDL 399 CSKYLYTLCV DSEKADKLKQSLPPGLTVQDL Sbjct: 38 CSKYLYTLCVFDSEKADKLKQSLPPGLTVQDL 69 >ref|XP_004302190.1| PREDICTED: 60S ribosomal protein L38 [Fragaria vesca subsp. vesca] Length = 69 Score = 67.0 bits (162), Expect = 8e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -3 Query: 494 CSKYLYTLCVHDSEKADKLKQSLPPGLTVQDL 399 CSKYLYTLCV DSEKADKLKQSLPPGLTVQDL Sbjct: 38 CSKYLYTLCVFDSEKADKLKQSLPPGLTVQDL 69 >ref|XP_022001977.1| 60S ribosomal protein L38 [Helianthus annuus] Length = 69 Score = 66.2 bits (160), Expect = 2e-11 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 494 CSKYLYTLCVHDSEKADKLKQSLPPGLTVQDL 399 CSKYLYTLCVHD +KADKLKQSLPPGL+VQDL Sbjct: 38 CSKYLYTLCVHDKDKADKLKQSLPPGLSVQDL 69 >ref|XP_021969932.1| 60S ribosomal protein L38-like [Helianthus annuus] ref|XP_022022131.1| 60S ribosomal protein L38-like [Helianthus annuus] gb|OTF85101.1| putative ribosomal protein L38e [Helianthus annuus] gb|OTG22604.1| putative ribosomal protein L38e [Helianthus annuus] Length = 69 Score = 65.9 bits (159), Expect = 2e-11 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -3 Query: 494 CSKYLYTLCVHDSEKADKLKQSLPPGLTVQDL 399 CSKYLYTLCVHD+EKA+KLKQSLPPGL+VQDL Sbjct: 38 CSKYLYTLCVHDAEKANKLKQSLPPGLSVQDL 69 >ref|XP_011007402.1| PREDICTED: 60S ribosomal protein L38-like [Populus euphratica] Length = 69 Score = 65.9 bits (159), Expect = 2e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 494 CSKYLYTLCVHDSEKADKLKQSLPPGLTVQDL 399 CSKYLYTLCV D+EKADKLKQSLPPGLTVQDL Sbjct: 38 CSKYLYTLCVFDTEKADKLKQSLPPGLTVQDL 69 >ref|XP_004289816.1| PREDICTED: 60S ribosomal protein L38-like [Fragaria vesca subsp. vesca] Length = 69 Score = 65.9 bits (159), Expect = 2e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 494 CSKYLYTLCVHDSEKADKLKQSLPPGLTVQDL 399 CSKYLYTLCV D+EKADKLKQSLPPGLTVQDL Sbjct: 38 CSKYLYTLCVFDTEKADKLKQSLPPGLTVQDL 69 >gb|AEJ20976.1| 60S ribosomal protein L38A [Caragana jubata] Length = 69 Score = 65.9 bits (159), Expect = 2e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 494 CSKYLYTLCVHDSEKADKLKQSLPPGLTVQDL 399 CSKYLYTLCV D+EKADKLKQSLPPGLTVQDL Sbjct: 38 CSKYLYTLCVFDTEKADKLKQSLPPGLTVQDL 69 >gb|KDO45681.1| hypothetical protein CISIN_1g0352561mg, partial [Citrus sinensis] Length = 68 Score = 65.5 bits (158), Expect = 3e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 494 CSKYLYTLCVHDSEKADKLKQSLPPGLTVQDL 399 CSKYLYTLCV DSEKADKLKQSLPPGL+VQDL Sbjct: 37 CSKYLYTLCVFDSEKADKLKQSLPPGLSVQDL 68 >ref|XP_024186514.1| 60S ribosomal protein L38 [Rosa chinensis] gb|PRQ41501.1| putative ribosomal protein L38e [Rosa chinensis] Length = 69 Score = 65.5 bits (158), Expect = 3e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 494 CSKYLYTLCVHDSEKADKLKQSLPPGLTVQDL 399 CSKYLYTLCV DSEKADKLKQSLPPGL+VQDL Sbjct: 38 CSKYLYTLCVFDSEKADKLKQSLPPGLSVQDL 69 >ref|XP_021774892.1| 60S ribosomal protein L38-like isoform X2 [Chenopodium quinoa] ref|XP_021774894.1| 60S ribosomal protein L38-like isoform X3 [Chenopodium quinoa] Length = 69 Score = 65.5 bits (158), Expect = 3e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 494 CSKYLYTLCVHDSEKADKLKQSLPPGLTVQDL 399 CSKYLYTLCV DSEKADKLKQSLPPGL+VQDL Sbjct: 38 CSKYLYTLCVFDSEKADKLKQSLPPGLSVQDL 69 >ref|WP_071414624.1| hypothetical protein [Acinetobacter baumannii] gb|OIC45660.1| hypothetical protein A7L55_20915 [Acinetobacter baumannii] Length = 69 Score = 65.5 bits (158), Expect = 3e-11 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -3 Query: 494 CSKYLYTLCVHDSEKADKLKQSLPPGLTVQDL 399 C KYLYTLCV DSEKADKLKQSLPPGLTVQDL Sbjct: 38 CKKYLYTLCVFDSEKADKLKQSLPPGLTVQDL 69 >ref|XP_008793782.1| PREDICTED: 60S ribosomal protein L38 [Phoenix dactylifera] Length = 69 Score = 65.5 bits (158), Expect = 3e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 494 CSKYLYTLCVHDSEKADKLKQSLPPGLTVQDL 399 CSKYLYTLCV DSEKADKLKQSLPPGL+VQDL Sbjct: 38 CSKYLYTLCVFDSEKADKLKQSLPPGLSVQDL 69 >ref|XP_006428680.1| 60S ribosomal protein L38 [Citrus clementina] ref|XP_006442967.1| 60S ribosomal protein L38 [Citrus clementina] ref|XP_006478751.1| PREDICTED: 60S ribosomal protein L38 [Citrus sinensis] ref|XP_006480494.1| PREDICTED: 60S ribosomal protein L38 [Citrus sinensis] ref|XP_011649040.1| PREDICTED: 60S ribosomal protein L38-like [Cucumis sativus] ref|XP_015935557.1| 60S ribosomal protein L38 [Arachis duranensis] ref|XP_016169189.1| 60S ribosomal protein L38 [Arachis ipaensis] ref|XP_022159055.1| 60S ribosomal protein L38-like isoform X3 [Momordica charantia] gb|ESR41920.1| hypothetical protein CICLE_v10013279mg [Citrus clementina] gb|ESR56206.1| hypothetical protein CICLE_v10023214mg [Citrus clementina] gb|ESR56207.1| hypothetical protein CICLE_v10023214mg [Citrus clementina] gb|KGN61359.1| hypothetical protein Csa_2G098440 [Cucumis sativus] dbj|GAY61948.1| hypothetical protein CUMW_213950 [Citrus unshiu] Length = 69 Score = 65.5 bits (158), Expect = 3e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 494 CSKYLYTLCVHDSEKADKLKQSLPPGLTVQDL 399 CSKYLYTLCV DSEKADKLKQSLPPGL+VQDL Sbjct: 38 CSKYLYTLCVFDSEKADKLKQSLPPGLSVQDL 69 >ref|XP_007207316.1| 60S ribosomal protein L38 [Prunus persica] ref|XP_008218474.1| PREDICTED: 60S ribosomal protein L38 [Prunus mume] ref|XP_008222531.1| PREDICTED: 60S ribosomal protein L38 [Prunus mume] ref|XP_007224245.2| 60S ribosomal protein L38 [Prunus persica] ref|XP_021805331.1| 60S ribosomal protein L38 [Prunus avium] ref|XP_023909162.1| 60S ribosomal protein L38 [Quercus suber] ref|XP_023928529.1| 60S ribosomal protein L38 [Quercus suber] gb|ONI05243.1| hypothetical protein PRUPE_6G363900 [Prunus persica] gb|ONI29323.1| hypothetical protein PRUPE_1G193400 [Prunus persica] gb|PIN21627.1| 60S ribosomal protein L38 [Handroanthus impetiginosus] gb|POE90775.1| 60s ribosomal protein l38 [Quercus suber] gb|POF14795.1| 60s ribosomal protein l38 [Quercus suber] Length = 69 Score = 65.5 bits (158), Expect = 3e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 494 CSKYLYTLCVHDSEKADKLKQSLPPGLTVQDL 399 CSKYLYTLCV DSEKADKLKQSLPPGL+VQDL Sbjct: 38 CSKYLYTLCVFDSEKADKLKQSLPPGLSVQDL 69 >ref|XP_003631881.1| PREDICTED: 60S ribosomal protein L38 [Vitis vinifera] ref|XP_004145035.1| PREDICTED: 60S ribosomal protein L38 [Cucumis sativus] ref|XP_008441729.1| PREDICTED: 60S ribosomal protein L38 [Cucumis melo] ref|XP_008460031.1| PREDICTED: 60S ribosomal protein L38 [Cucumis melo] ref|XP_008460032.1| PREDICTED: 60S ribosomal protein L38 [Cucumis melo] ref|XP_010258506.1| PREDICTED: 60S ribosomal protein L38 [Nelumbo nucifera] ref|XP_010242739.1| PREDICTED: 60S ribosomal protein L38 [Nelumbo nucifera] ref|XP_010672261.1| PREDICTED: 60S ribosomal protein L38 [Beta vulgaris subsp. vulgaris] ref|XP_010673886.1| PREDICTED: 60S ribosomal protein L38 [Beta vulgaris subsp. vulgaris] ref|XP_011620720.1| 60S ribosomal protein L38 [Amborella trichopoda] ref|XP_011656729.1| PREDICTED: 60S ribosomal protein L38 [Cucumis sativus] ref|XP_015583639.1| PREDICTED: 60S ribosomal protein L38 [Ricinus communis] ref|XP_002514807.2| PREDICTED: 60S ribosomal protein L38 [Ricinus communis] ref|XP_021680970.1| 60S ribosomal protein L38 [Hevea brasiliensis] ref|XP_021647103.1| 60S ribosomal protein L38 [Hevea brasiliensis] ref|XP_021772297.1| 60S ribosomal protein L38 [Chenopodium quinoa] ref|XP_021734344.1| 60S ribosomal protein L38 [Chenopodium quinoa] ref|XP_021896712.1| 60S ribosomal protein L38 [Carica papaya] ref|XP_021906662.1| 60S ribosomal protein L38 [Carica papaya] ref|XP_022145242.1| 60S ribosomal protein L38 [Momordica charantia] ref|XP_022145247.1| 60S ribosomal protein L38 [Momordica charantia] ref|XP_022946385.1| 60S ribosomal protein L38 isoform X2 [Cucurbita moschata] ref|XP_022946386.1| 60S ribosomal protein L38 [Cucurbita moschata] ref|XP_022949560.1| 60S ribosomal protein L38 [Cucurbita moschata] ref|XP_022959603.1| 60S ribosomal protein L38 [Cucurbita moschata] ref|XP_022997957.1| 60S ribosomal protein L38 [Cucurbita maxima] ref|XP_023004176.1| 60S ribosomal protein L38 [Cucurbita maxima] ref|XP_022972864.1| 60S ribosomal protein L38 isoform X2 [Cucurbita maxima] ref|XP_022972865.1| 60S ribosomal protein L38 [Cucurbita maxima] ref|XP_023524963.1| 60S ribosomal protein L38 [Cucurbita pepo subsp. pepo] ref|XP_023545548.1| 60S ribosomal protein L38 isoform X2 [Cucurbita pepo subsp. pepo] ref|XP_023545639.1| 60S ribosomal protein L38 isoform X2 [Cucurbita pepo subsp. pepo] ref|XP_023513714.1| 60S ribosomal protein L38 [Cucurbita pepo subsp. pepo] ref|XP_024031738.1| 60S ribosomal protein L38 [Morus notabilis] ref|XP_024024522.1| 60S ribosomal protein L38 [Morus notabilis] gb|KCW46089.1| hypothetical protein EUGRSUZ_K00006 [Eucalyptus grandis] gb|KGN46309.1| hypothetical protein Csa_6G081500 [Cucumis sativus] gb|KMT14714.1| hypothetical protein BVRB_4g074810 [Beta vulgaris subsp. vulgaris] gb|KMT15805.1| hypothetical protein BVRB_3g057800 [Beta vulgaris subsp. vulgaris] gb|OAY32247.1| hypothetical protein MANES_13G002900 [Manihot esculenta] gb|OAY34206.1| hypothetical protein MANES_12G002500 [Manihot esculenta] gb|OAY37743.1| hypothetical protein MANES_11G125700 [Manihot esculenta] gb|OWM91557.1| hypothetical protein CDL15_Pgr028296 [Punica granatum] gb|PON32581.1| Ribosomal protein [Parasponia andersonii] gb|PON93714.1| Ribosomal protein [Trema orientalis] Length = 69 Score = 65.5 bits (158), Expect = 3e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 494 CSKYLYTLCVHDSEKADKLKQSLPPGLTVQDL 399 CSKYLYTLCV DSEKADKLKQSLPPGL+VQDL Sbjct: 38 CSKYLYTLCVFDSEKADKLKQSLPPGLSVQDL 69 >ref|XP_021774891.1| 60S ribosomal protein L38-like isoform X1 [Chenopodium quinoa] Length = 70 Score = 65.5 bits (158), Expect = 3e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 494 CSKYLYTLCVHDSEKADKLKQSLPPGLTVQDL 399 CSKYLYTLCV DSEKADKLKQSLPPGL+VQDL Sbjct: 39 CSKYLYTLCVFDSEKADKLKQSLPPGLSVQDL 70 >ref|XP_022946384.1| 60S ribosomal protein L38 isoform X1 [Cucurbita moschata] ref|XP_022972863.1| 60S ribosomal protein L38 isoform X1 [Cucurbita maxima] ref|XP_023545547.1| 60S ribosomal protein L38 isoform X1 [Cucurbita pepo subsp. pepo] ref|XP_023545638.1| 60S ribosomal protein L38 isoform X1 [Cucurbita pepo subsp. pepo] Length = 72 Score = 65.5 bits (158), Expect = 4e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 494 CSKYLYTLCVHDSEKADKLKQSLPPGLTVQDL 399 CSKYLYTLCV DSEKADKLKQSLPPGL+VQDL Sbjct: 41 CSKYLYTLCVFDSEKADKLKQSLPPGLSVQDL 72