BLASTX nr result
ID: Ophiopogon27_contig00006205
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00006205 (782 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020257979.1| uncharacterized protein LOC109834380 isoform... 57 9e-06 ref|XP_020257978.1| uncharacterized protein LOC109834380 isoform... 57 1e-05 >ref|XP_020257979.1| uncharacterized protein LOC109834380 isoform X4 [Asparagus officinalis] Length = 432 Score = 57.4 bits (137), Expect = 9e-06 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -3 Query: 123 KFSSFERWT*ARPDVQTCVLLVLGLAASFQVSDAIRIFTYV 1 K S +RW+ ARPDV+TC LLV GLAAS +VSDAI I TYV Sbjct: 4 KISDLDRWSWARPDVRTCSLLVQGLAASLRVSDAIMIITYV 44 >ref|XP_020257978.1| uncharacterized protein LOC109834380 isoform X3 [Asparagus officinalis] Length = 550 Score = 57.4 bits (137), Expect = 1e-05 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -3 Query: 123 KFSSFERWT*ARPDVQTCVLLVLGLAASFQVSDAIRIFTYV 1 K S +RW+ ARPDV+TC LLV GLAAS +VSDAI I TYV Sbjct: 146 KISDLDRWSWARPDVRTCSLLVQGLAASLRVSDAIMIITYV 186