BLASTX nr result
ID: Ophiopogon27_contig00006036
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00006036 (578 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008798060.1| PREDICTED: U-box domain-containing protein 4... 59 1e-06 ref|XP_010913476.1| PREDICTED: U-box domain-containing protein 3... 57 6e-06 >ref|XP_008798060.1| PREDICTED: U-box domain-containing protein 41-like [Phoenix dactylifera] Length = 557 Score = 58.5 bits (140), Expect = 1e-06 Identities = 28/62 (45%), Positives = 41/62 (66%) Frame = -1 Query: 188 DSEAEAILVKLKSPQISFKESGLVTLRHSARESSHRRISLCTPSLLSALVPTILSTNPSI 9 D E I +KL P++S +E+ L LR + RES +RI+LCTP LL++L P +LS P + Sbjct: 219 DCLEEEISIKLMDPEVSEQEAALAALRQATRESRDQRIALCTPRLLASLRPMLLSRCPGV 278 Query: 8 QI 3 Q+ Sbjct: 279 QV 280 >ref|XP_010913476.1| PREDICTED: U-box domain-containing protein 39-like [Elaeis guineensis] Length = 558 Score = 56.6 bits (135), Expect = 6e-06 Identities = 28/62 (45%), Positives = 40/62 (64%) Frame = -1 Query: 188 DSEAEAILVKLKSPQISFKESGLVTLRHSARESSHRRISLCTPSLLSALVPTILSTNPSI 9 D E I +KL + ++S +E+ L LR + RES RRI+LCTP LL+ L P +LS P + Sbjct: 221 DCLEEEISIKLMNSEVSEQEAALAALRQATRESRDRRIALCTPRLLATLRPMLLSRWPGV 280 Query: 8 QI 3 Q+ Sbjct: 281 QV 282