BLASTX nr result
ID: Ophiopogon27_contig00005511
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00005511 (513 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020275490.1| probable protein phosphatase 2C 73 [Asparagu... 55 3e-06 >ref|XP_020275490.1| probable protein phosphatase 2C 73 [Asparagus officinalis] gb|ONK63407.1| uncharacterized protein A4U43_C07F14820 [Asparagus officinalis] Length = 182 Score = 55.5 bits (132), Expect = 3e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 513 VDAELEHHRKMDSFNSGTTALTIVKQVINRYA 418 VDAELEHHRK DSFNSGTTALT+VKQV+ ++ Sbjct: 148 VDAELEHHRKFDSFNSGTTALTLVKQVLTFFS 179