BLASTX nr result
ID: Ophiopogon27_contig00005350
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00005350 (542 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020272734.1| glycine-rich domain-containing protein 1 [As... 56 6e-06 gb|ONK65372.1| uncharacterized protein A4U43_C07F36430 [Asparagu... 56 6e-06 >ref|XP_020272734.1| glycine-rich domain-containing protein 1 [Asparagus officinalis] Length = 736 Score = 56.2 bits (134), Expect = 6e-06 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +3 Query: 6 DEDRFVLPTIILLFILKKEGYTGENIKQISSPEVKT 113 DED+FVLP I+LLFILKKEG TG+NIKQ+++ E KT Sbjct: 619 DEDQFVLPAILLLFILKKEGLTGKNIKQMANQESKT 654 >gb|ONK65372.1| uncharacterized protein A4U43_C07F36430 [Asparagus officinalis] Length = 811 Score = 56.2 bits (134), Expect = 6e-06 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +3 Query: 6 DEDRFVLPTIILLFILKKEGYTGENIKQISSPEVKT 113 DED+FVLP I+LLFILKKEG TG+NIKQ+++ E KT Sbjct: 678 DEDQFVLPAILLLFILKKEGLTGKNIKQMANQESKT 713