BLASTX nr result
ID: Ophiopogon27_contig00005292
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00005292 (425 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABR25509.1| retotransposon sine subfamily, partial [Oryza sat... 81 1e-17 gb|ONM09042.1| Helix-loop-helix DNA-binding domain containing pr... 82 3e-17 ref|XP_008670969.2| aspartic proteinase [Zea mays] >gi|116245988... 82 5e-17 ref|XP_008665388.1| aspartic proteinase isoform X4 [Zea mays] 82 9e-17 gb|ABR25873.1| retrotransposon protein, sine subclass, expressed... 81 1e-16 ref|XP_020402514.1| aspartic proteinase isoform X3 [Zea mays] >g... 82 1e-16 gb|ONM27859.1| Aspartic proteinase A1 [Zea mays] 82 1e-16 ref|XP_008665386.1| aspartic proteinase isoform X2 [Zea mays] >g... 82 1e-16 ref|XP_008678986.1| aspartic proteinase-like isoform X3 [Zea may... 80 1e-16 ref|XP_008678985.1| aspartic proteinase-like isoform X2 [Zea mays] 80 2e-16 ref|XP_008665385.1| aspartic proteinase isoform X1 [Zea mays] 82 2e-16 ref|XP_020396632.1| aspartic proteinase isoform X2 [Zea mays] >g... 79 2e-16 ref|XP_020408250.1| aspartic proteinase-like isoform X1 [Zea mays] 80 3e-16 ref|XP_008653493.1| aspartic proteinase isoform X1 [Zea mays] 79 3e-16 gb|AGS43130.1| hypothetical protein, partial [Zea mays] 77 4e-16 dbj|BAA78908.1| aspartic proteinase, partial [Oryza sativa] 78 6e-16 ref|XP_004967621.1| aspartic proteinase [Setaria italica] >gi|51... 83 1e-15 gb|PAN31190.1| hypothetical protein PAHAL_E03237 [Panicum hallii] 83 1e-15 gb|OEL32417.1| Aspartic proteinase [Dichanthelium oligosanthes] 83 1e-15 gb|ACL54337.1| unknown [Zea mays] 82 2e-15 >gb|ABR25509.1| retotransposon sine subfamily, partial [Oryza sativa Indica Group] Length = 52 Score = 80.9 bits (198), Expect = 1e-17 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +3 Query: 3 AFDIPPPRGPLWILGDVFMGVYHTVFDFGANRIGFAKAA 119 AFD+PPPRGPLWILGDVFMG YHTVFDFG NRIGFA++A Sbjct: 14 AFDVPPPRGPLWILGDVFMGAYHTVFDFGKNRIGFAESA 52 >gb|ONM09042.1| Helix-loop-helix DNA-binding domain containing protein [Zea mays] Length = 117 Score = 81.6 bits (200), Expect = 3e-17 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +3 Query: 3 AFDIPPPRGPLWILGDVFMGVYHTVFDFGANRIGFAKAA 119 AFD+PPPRGPLWILGDVFMGVYHTVFDFG N IGFAK+A Sbjct: 79 AFDVPPPRGPLWILGDVFMGVYHTVFDFGENMIGFAKSA 117 >ref|XP_008670969.2| aspartic proteinase [Zea mays] ref|XP_008670970.2| aspartic proteinase [Zea mays] Length = 141 Score = 81.6 bits (200), Expect = 5e-17 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +3 Query: 3 AFDIPPPRGPLWILGDVFMGVYHTVFDFGANRIGFAKAA 119 AFD+PPPRGPLWILGDVFMGVYHTVFDFG N IGFAK+A Sbjct: 103 AFDVPPPRGPLWILGDVFMGVYHTVFDFGENMIGFAKSA 141 >ref|XP_008665388.1| aspartic proteinase isoform X4 [Zea mays] Length = 161 Score = 81.6 bits (200), Expect = 9e-17 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +3 Query: 3 AFDIPPPRGPLWILGDVFMGVYHTVFDFGANRIGFAKAA 119 AFD+PPPRGPLWILGDVFMGVYHTVFDFG N IGFAK+A Sbjct: 123 AFDVPPPRGPLWILGDVFMGVYHTVFDFGENMIGFAKSA 161 >gb|ABR25873.1| retrotransposon protein, sine subclass, expressed, partial [Oryza sativa Indica Group] Length = 140 Score = 80.9 bits (198), Expect = 1e-16 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +3 Query: 3 AFDIPPPRGPLWILGDVFMGVYHTVFDFGANRIGFAKAA 119 AFD+PPPRGPLWILGDVFMG YHTVFDFG NRIGFA++A Sbjct: 102 AFDVPPPRGPLWILGDVFMGAYHTVFDFGKNRIGFAESA 140 >ref|XP_020402514.1| aspartic proteinase isoform X3 [Zea mays] ref|XP_020402515.1| aspartic proteinase isoform X3 [Zea mays] Length = 169 Score = 81.6 bits (200), Expect = 1e-16 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +3 Query: 3 AFDIPPPRGPLWILGDVFMGVYHTVFDFGANRIGFAKAA 119 AFD+PPPRGPLWILGDVFMGVYHTVFDFG N IGFAK+A Sbjct: 131 AFDVPPPRGPLWILGDVFMGVYHTVFDFGENMIGFAKSA 169 >gb|ONM27859.1| Aspartic proteinase A1 [Zea mays] Length = 170 Score = 81.6 bits (200), Expect = 1e-16 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +3 Query: 3 AFDIPPPRGPLWILGDVFMGVYHTVFDFGANRIGFAKAA 119 AFD+PPPRGPLWILGDVFMGVYHTVFDFG N IGFAK+A Sbjct: 132 AFDVPPPRGPLWILGDVFMGVYHTVFDFGENMIGFAKSA 170 >ref|XP_008665386.1| aspartic proteinase isoform X2 [Zea mays] ref|XP_020402511.1| aspartic proteinase isoform X2 [Zea mays] ref|XP_020402512.1| aspartic proteinase isoform X2 [Zea mays] ref|XP_020402513.1| aspartic proteinase isoform X2 [Zea mays] Length = 170 Score = 81.6 bits (200), Expect = 1e-16 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +3 Query: 3 AFDIPPPRGPLWILGDVFMGVYHTVFDFGANRIGFAKAA 119 AFD+PPPRGPLWILGDVFMGVYHTVFDFG N IGFAK+A Sbjct: 132 AFDVPPPRGPLWILGDVFMGVYHTVFDFGENMIGFAKSA 170 >ref|XP_008678986.1| aspartic proteinase-like isoform X3 [Zea mays] ref|XP_020408251.1| aspartic proteinase-like isoform X3 [Zea mays] Length = 131 Score = 80.5 bits (197), Expect = 1e-16 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +3 Query: 3 AFDIPPPRGPLWILGDVFMGVYHTVFDFGANRIGFAKAA 119 +FD+PPPRGPLWILGDVFMGVYHTVFDFG N IGFAK+A Sbjct: 93 SFDVPPPRGPLWILGDVFMGVYHTVFDFGENMIGFAKSA 131 >ref|XP_008678985.1| aspartic proteinase-like isoform X2 [Zea mays] Length = 141 Score = 80.5 bits (197), Expect = 2e-16 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +3 Query: 3 AFDIPPPRGPLWILGDVFMGVYHTVFDFGANRIGFAKAA 119 +FD+PPPRGPLWILGDVFMGVYHTVFDFG N IGFAK+A Sbjct: 103 SFDVPPPRGPLWILGDVFMGVYHTVFDFGENMIGFAKSA 141 >ref|XP_008665385.1| aspartic proteinase isoform X1 [Zea mays] Length = 186 Score = 81.6 bits (200), Expect = 2e-16 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +3 Query: 3 AFDIPPPRGPLWILGDVFMGVYHTVFDFGANRIGFAKAA 119 AFD+PPPRGPLWILGDVFMGVYHTVFDFG N IGFAK+A Sbjct: 148 AFDVPPPRGPLWILGDVFMGVYHTVFDFGENMIGFAKSA 186 >ref|XP_020396632.1| aspartic proteinase isoform X2 [Zea mays] ref|XP_020396633.1| aspartic proteinase isoform X2 [Zea mays] Length = 117 Score = 79.3 bits (194), Expect = 2e-16 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = +3 Query: 3 AFDIPPPRGPLWILGDVFMGVYHTVFDFGANRIGFAKAA 119 AFD+PPPRGPLWILGDVFM VYHTVFDFG N IGFAK+A Sbjct: 79 AFDVPPPRGPLWILGDVFMSVYHTVFDFGENMIGFAKSA 117 >ref|XP_020408250.1| aspartic proteinase-like isoform X1 [Zea mays] Length = 169 Score = 80.5 bits (197), Expect = 3e-16 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +3 Query: 3 AFDIPPPRGPLWILGDVFMGVYHTVFDFGANRIGFAKAA 119 +FD+PPPRGPLWILGDVFMGVYHTVFDFG N IGFAK+A Sbjct: 131 SFDVPPPRGPLWILGDVFMGVYHTVFDFGENMIGFAKSA 169 >ref|XP_008653493.1| aspartic proteinase isoform X1 [Zea mays] Length = 131 Score = 79.3 bits (194), Expect = 3e-16 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = +3 Query: 3 AFDIPPPRGPLWILGDVFMGVYHTVFDFGANRIGFAKAA 119 AFD+PPPRGPLWILGDVFM VYHTVFDFG N IGFAK+A Sbjct: 93 AFDVPPPRGPLWILGDVFMSVYHTVFDFGENMIGFAKSA 131 >gb|AGS43130.1| hypothetical protein, partial [Zea mays] Length = 72 Score = 77.4 bits (189), Expect = 4e-16 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = +3 Query: 3 AFDIPPPRGPLWILGDVFMGVYHTVFDFGANRIGFAKAA 119 A+D+PPPRGPLWILGDVFMG YHTVFDFG +RIGFA++A Sbjct: 34 AYDVPPPRGPLWILGDVFMGAYHTVFDFGNDRIGFAESA 72 >dbj|BAA78908.1| aspartic proteinase, partial [Oryza sativa] Length = 111 Score = 78.2 bits (191), Expect = 6e-16 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = +3 Query: 3 AFDIPPPRGPLWILGDVFMGVYHTVFDFGANRIGFAKAA 119 AFDIPPPRGPLWILGDVFMG YHTVFDFG +RIG AK+A Sbjct: 54 AFDIPPPRGPLWILGDVFMGAYHTVFDFGKDRIGVAKSA 92 >ref|XP_004967621.1| aspartic proteinase [Setaria italica] ref|XP_004967622.1| aspartic proteinase [Setaria italica] gb|KQL03552.1| hypothetical protein SETIT_001142mg [Setaria italica] gb|KQL03553.1| hypothetical protein SETIT_001142mg [Setaria italica] Length = 501 Score = 82.8 bits (203), Expect = 1e-15 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = +3 Query: 3 AFDIPPPRGPLWILGDVFMGVYHTVFDFGANRIGFAKAA 119 AFDIPPPRGPLWILGDVFMG YHTVFDFG NRIGFAK+A Sbjct: 463 AFDIPPPRGPLWILGDVFMGAYHTVFDFGENRIGFAKSA 501 >gb|PAN31190.1| hypothetical protein PAHAL_E03237 [Panicum hallii] Length = 502 Score = 82.8 bits (203), Expect = 1e-15 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = +3 Query: 3 AFDIPPPRGPLWILGDVFMGVYHTVFDFGANRIGFAKAA 119 AFDIPPPRGPLWILGDVFMG YHTVFDFG NRIGFAK+A Sbjct: 464 AFDIPPPRGPLWILGDVFMGAYHTVFDFGENRIGFAKSA 502 >gb|OEL32417.1| Aspartic proteinase [Dichanthelium oligosanthes] Length = 502 Score = 82.8 bits (203), Expect = 1e-15 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = +3 Query: 3 AFDIPPPRGPLWILGDVFMGVYHTVFDFGANRIGFAKAA 119 AFDIPPPRGPLWILGDVFMG YHTVFDFG NRIGFAK+A Sbjct: 464 AFDIPPPRGPLWILGDVFMGAYHTVFDFGENRIGFAKSA 502 >gb|ACL54337.1| unknown [Zea mays] Length = 504 Score = 82.4 bits (202), Expect = 2e-15 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +3 Query: 3 AFDIPPPRGPLWILGDVFMGVYHTVFDFGANRIGFAKAA 119 AFD+PPPRGPLWILGDVFMG YHTVFDFG NRIGFAK+A Sbjct: 466 AFDVPPPRGPLWILGDVFMGAYHTVFDFGENRIGFAKSA 504