BLASTX nr result
ID: Ophiopogon27_contig00004886
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00004886 (1481 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK75645.1| uncharacterized protein A4U43_C03F19050 [Asparagu... 104 2e-31 ref|XP_020257491.1| transcription factor SAC51-like [Asparagus o... 99 9e-20 ref|XP_020273697.1| transcription factor bHLH144-like [Asparagus... 69 3e-09 gb|PON40251.1| hypothetical protein PanWU01x14_298860 [Parasponi... 62 8e-09 gb|PKI73544.1| hypothetical protein CRG98_006125 [Punica granatum] 62 8e-09 gb|PIM97324.1| hypothetical protein CDL12_30205 [Handroanthus im... 62 8e-09 ref|XP_017189409.1| PREDICTED: uncharacterized protein LOC103441... 62 8e-09 ref|XP_016900036.1| PREDICTED: uncharacterized protein LOC103488... 62 8e-09 ref|XP_016650881.1| PREDICTED: uncharacterized protein LOC103335... 62 8e-09 ref|XP_015571559.1| PREDICTED: uncharacterized protein LOC826838... 62 8e-09 ref|XP_006386421.1| hypothetical protein POPTR_0002s10360g [Popu... 62 8e-09 gb|ERN02911.1| hypothetical protein AMTR_s00135p00067350 [Ambore... 62 8e-09 ref|XP_017608364.1| PREDICTED: uncharacterized protein LOC108454... 62 1e-08 ref|XP_016681882.1| PREDICTED: uncharacterized protein LOC107900... 62 1e-08 gb|PRQ21286.1| hypothetical protein RchiOBHm_Chr7g0237501 [Rosa ... 61 1e-08 gb|PNT28336.1| hypothetical protein POPTR_007G112900v3 [Populus ... 61 2e-08 gb|OTG26855.1| hypothetical protein HannXRQ_Chr05g0163291 [Helia... 61 2e-08 gb|OAY39526.1| hypothetical protein MANES_10G102000 [Manihot esc... 61 2e-08 gb|OAY45162.1| hypothetical protein MANES_07G036900 [Manihot esc... 60 3e-08 gb|PIM97927.1| hypothetical protein CDL12_29599 [Handroanthus im... 60 4e-08 >gb|ONK75645.1| uncharacterized protein A4U43_C03F19050 [Asparagus officinalis] Length = 327 Score = 104 bits (260), Expect(2) = 2e-31 Identities = 49/61 (80%), Positives = 52/61 (85%) Frame = -1 Query: 185 TGAFLMGKDCDPWQFRSFNCASNVGAPAPAKQSTNSMVCPTYADPYGFFHLNSALMPPSN 6 +GA LM KDCD Q RSFNCA+NVGAPA AKQSTN +V PTYADPYGFFHLN ALMPPSN Sbjct: 61 SGAVLMEKDCDHLQLRSFNCATNVGAPALAKQSTNPVVFPTYADPYGFFHLNPALMPPSN 120 Query: 5 P 3 P Sbjct: 121 P 121 Score = 62.0 bits (149), Expect(2) = 2e-31 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -2 Query: 373 IIVRVIACFQPLQDCQAEYFRHLLKPVT 290 IIVRVIACFQPLQDCQAEYFRHLLKPVT Sbjct: 26 IIVRVIACFQPLQDCQAEYFRHLLKPVT 53 >ref|XP_020257491.1| transcription factor SAC51-like [Asparagus officinalis] Length = 262 Score = 99.4 bits (246), Expect = 9e-20 Identities = 46/56 (82%), Positives = 48/56 (85%) Frame = -1 Query: 170 MGKDCDPWQFRSFNCASNVGAPAPAKQSTNSMVCPTYADPYGFFHLNSALMPPSNP 3 M KDCD Q RSFNCA+NVGAPA AKQSTN +V PTYADPYGFFHLN ALMPPSNP Sbjct: 1 MEKDCDHLQLRSFNCATNVGAPALAKQSTNPVVFPTYADPYGFFHLNPALMPPSNP 56 >ref|XP_020273697.1| transcription factor bHLH144-like [Asparagus officinalis] gb|ONK64351.1| uncharacterized protein A4U43_C07F24910 [Asparagus officinalis] Length = 245 Score = 68.6 bits (166), Expect = 3e-09 Identities = 36/57 (63%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = -1 Query: 170 MGKDCDPWQFRSFNCASNVGAPA-PAKQSTNSMVCPTYADPYGFFHLNSALMPPSNP 3 MG+D DPWQ RSFNC SNVGA A KQSTN P YADP+GFF N M SNP Sbjct: 1 MGEDFDPWQLRSFNCESNVGASALDPKQSTN----PNYADPFGFFSPNPFSMQSSNP 53 >gb|PON40251.1| hypothetical protein PanWU01x14_298860 [Parasponia andersonii] gb|PON87350.1| hypothetical protein TorRG33x02_168420 [Trema orientalis] Length = 53 Score = 62.0 bits (149), Expect = 8e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -2 Query: 373 IIVRVIACFQPLQDCQAEYFRHLLKPVT 290 IIVRVIACFQPLQDCQAEYFRHLLKPVT Sbjct: 26 IIVRVIACFQPLQDCQAEYFRHLLKPVT 53 >gb|PKI73544.1| hypothetical protein CRG98_006125 [Punica granatum] Length = 53 Score = 62.0 bits (149), Expect = 8e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -2 Query: 373 IIVRVIACFQPLQDCQAEYFRHLLKPVT 290 IIVRVIACFQPLQDCQAEYFRHLLKPVT Sbjct: 26 IIVRVIACFQPLQDCQAEYFRHLLKPVT 53 >gb|PIM97324.1| hypothetical protein CDL12_30205 [Handroanthus impetiginosus] gb|PIN10866.1| hypothetical protein CDL12_16538 [Handroanthus impetiginosus] Length = 53 Score = 62.0 bits (149), Expect = 8e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -2 Query: 373 IIVRVIACFQPLQDCQAEYFRHLLKPVT 290 IIVRVIACFQPLQDCQAEYFRHLLKPVT Sbjct: 26 IIVRVIACFQPLQDCQAEYFRHLLKPVT 53 >ref|XP_017189409.1| PREDICTED: uncharacterized protein LOC103441648 [Malus domestica] gb|ONI35289.1| hypothetical protein PRUPE_1G527700 [Prunus persica] gb|PHT50804.1| hypothetical protein CQW23_10551 [Capsicum baccatum] gb|PHT84316.1| hypothetical protein T459_12759 [Capsicum annuum] gb|PHU20446.1| hypothetical protein BC332_11597 [Capsicum chinense] Length = 53 Score = 62.0 bits (149), Expect = 8e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -2 Query: 373 IIVRVIACFQPLQDCQAEYFRHLLKPVT 290 IIVRVIACFQPLQDCQAEYFRHLLKPVT Sbjct: 26 IIVRVIACFQPLQDCQAEYFRHLLKPVT 53 >ref|XP_016900036.1| PREDICTED: uncharacterized protein LOC103488104 isoform X2 [Cucumis melo] ref|XP_016900037.1| PREDICTED: uncharacterized protein LOC103488104 isoform X2 [Cucumis melo] Length = 53 Score = 62.0 bits (149), Expect = 8e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -2 Query: 373 IIVRVIACFQPLQDCQAEYFRHLLKPVT 290 IIVRVIACFQPLQDCQAEYFRHLLKPVT Sbjct: 26 IIVRVIACFQPLQDCQAEYFRHLLKPVT 53 >ref|XP_016650881.1| PREDICTED: uncharacterized protein LOC103335959 isoform X2 [Prunus mume] gb|ONH90663.1| hypothetical protein PRUPE_8G067700 [Prunus persica] Length = 53 Score = 62.0 bits (149), Expect = 8e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -2 Query: 373 IIVRVIACFQPLQDCQAEYFRHLLKPVT 290 IIVRVIACFQPLQDCQAEYFRHLLKPVT Sbjct: 26 IIVRVIACFQPLQDCQAEYFRHLLKPVT 53 >ref|XP_015571559.1| PREDICTED: uncharacterized protein LOC8268387 isoform X2 [Ricinus communis] Length = 53 Score = 62.0 bits (149), Expect = 8e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -2 Query: 373 IIVRVIACFQPLQDCQAEYFRHLLKPVT 290 IIVRVIACFQPLQDCQAEYFRHLLKPVT Sbjct: 26 IIVRVIACFQPLQDCQAEYFRHLLKPVT 53 >ref|XP_006386421.1| hypothetical protein POPTR_0002s10360g [Populus trichocarpa] ref|XP_006383513.1| hypothetical protein POPTR_0005s17700g [Populus trichocarpa] gb|PNT36938.1| hypothetical protein POPTR_005G158000v3 [Populus trichocarpa] gb|PNT48938.1| hypothetical protein POPTR_002G103400v3 [Populus trichocarpa] Length = 53 Score = 62.0 bits (149), Expect = 8e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -2 Query: 373 IIVRVIACFQPLQDCQAEYFRHLLKPVT 290 IIVRVIACFQPLQDCQAEYFRHLLKPVT Sbjct: 26 IIVRVIACFQPLQDCQAEYFRHLLKPVT 53 >gb|ERN02911.1| hypothetical protein AMTR_s00135p00067350 [Amborella trichopoda] Length = 53 Score = 62.0 bits (149), Expect = 8e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -2 Query: 373 IIVRVIACFQPLQDCQAEYFRHLLKPVT 290 IIVRVIACFQPLQDCQAEYFRHLLKPVT Sbjct: 26 IIVRVIACFQPLQDCQAEYFRHLLKPVT 53 >ref|XP_017608364.1| PREDICTED: uncharacterized protein LOC108454417 [Gossypium arboreum] Length = 53 Score = 61.6 bits (148), Expect = 1e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -2 Query: 373 IIVRVIACFQPLQDCQAEYFRHLLKPVT 290 I+VRVIACFQPLQDCQAEYFRHLLKPVT Sbjct: 26 IVVRVIACFQPLQDCQAEYFRHLLKPVT 53 >ref|XP_016681882.1| PREDICTED: uncharacterized protein LOC107900702 [Gossypium hirsutum] Length = 53 Score = 61.6 bits (148), Expect = 1e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -2 Query: 373 IIVRVIACFQPLQDCQAEYFRHLLKPVT 290 I+VRVIACFQPLQDCQAEYFRHLLKPVT Sbjct: 26 IVVRVIACFQPLQDCQAEYFRHLLKPVT 53 >gb|PRQ21286.1| hypothetical protein RchiOBHm_Chr7g0237501 [Rosa chinensis] Length = 53 Score = 61.2 bits (147), Expect = 1e-08 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -2 Query: 373 IIVRVIACFQPLQDCQAEYFRHLLKPVT 290 I++RVIACFQPLQDCQAEYFRHLLKPVT Sbjct: 26 IVIRVIACFQPLQDCQAEYFRHLLKPVT 53 >gb|PNT28336.1| hypothetical protein POPTR_007G112900v3 [Populus trichocarpa] Length = 53 Score = 60.8 bits (146), Expect = 2e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -2 Query: 373 IIVRVIACFQPLQDCQAEYFRHLLKPVT 290 IIVRVIAC+QPLQDCQAEYFRHLLKPVT Sbjct: 26 IIVRVIACYQPLQDCQAEYFRHLLKPVT 53 >gb|OTG26855.1| hypothetical protein HannXRQ_Chr05g0163291 [Helianthus annuus] gb|OTG26879.1| hypothetical protein HannXRQ_Chr05g0163551 [Helianthus annuus] Length = 53 Score = 60.8 bits (146), Expect = 2e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -2 Query: 373 IIVRVIACFQPLQDCQAEYFRHLLKPVT 290 IIV+VIACFQPLQDCQAEYFRHLLKPVT Sbjct: 26 IIVKVIACFQPLQDCQAEYFRHLLKPVT 53 >gb|OAY39526.1| hypothetical protein MANES_10G102000 [Manihot esculenta] Length = 53 Score = 60.8 bits (146), Expect = 2e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -2 Query: 373 IIVRVIACFQPLQDCQAEYFRHLLKPVT 290 IIVRVIAC+QPLQDCQAEYFRHLLKPVT Sbjct: 26 IIVRVIACYQPLQDCQAEYFRHLLKPVT 53 >gb|OAY45162.1| hypothetical protein MANES_07G036900 [Manihot esculenta] Length = 53 Score = 60.5 bits (145), Expect = 3e-08 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -2 Query: 373 IIVRVIACFQPLQDCQAEYFRHLLKPVT 290 I+VRVIAC+QPLQDCQAEYFRHLLKPVT Sbjct: 26 IVVRVIACYQPLQDCQAEYFRHLLKPVT 53 >gb|PIM97927.1| hypothetical protein CDL12_29599 [Handroanthus impetiginosus] gb|PIN00498.1| hypothetical protein CDL12_26997 [Handroanthus impetiginosus] Length = 53 Score = 60.1 bits (144), Expect = 4e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -2 Query: 373 IIVRVIACFQPLQDCQAEYFRHLLKPVT 290 IIVRVIACFQPLQ+CQAEYFRHLLKPVT Sbjct: 26 IIVRVIACFQPLQNCQAEYFRHLLKPVT 53