BLASTX nr result
ID: Ophiopogon27_contig00004756
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00004756 (584 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020267656.1| two-component response regulator ARR2-like [... 73 1e-11 ref|XP_020097739.1| transcription factor LUX [Ananas comosus] 65 6e-10 ref|XP_002316821.1| myb family transcription factor family prote... 65 7e-10 gb|PKU70268.1| Putative Myb family transcription factor [Dendrob... 67 8e-10 gb|PON42508.1| Homeodomain-like [Parasponia andersonii] 63 1e-09 gb|PON93998.1| Homeodomain-like [Trema orientalis] 63 1e-09 gb|OVA13616.1| SANT/Myb domain [Macleaya cordata] 65 1e-09 gb|KDO77871.1| hypothetical protein CISIN_1g035517mg [Citrus sin... 64 2e-09 gb|KQL10921.1| hypothetical protein SETIT_006312mg [Setaria ital... 67 2e-09 dbj|GAU41935.1| hypothetical protein TSUD_380400 [Trifolium subt... 62 2e-09 gb|OAY76265.1| putative Myb family transcription factor [Ananas ... 66 4e-09 gb|OAY83208.1| putative Myb family transcription factor [Ananas ... 66 4e-09 gb|KQL27938.1| hypothetical protein SETIT_016955mg [Setaria ital... 66 4e-09 gb|PAN04932.1| hypothetical protein PAHAL_A00979 [Panicum hallii] 66 4e-09 gb|PAN04931.1| hypothetical protein PAHAL_A00979 [Panicum hallii] 66 4e-09 ref|XP_021304606.1| uncharacterized protein LOC8072684 [Sorghum ... 66 4e-09 ref|XP_004951340.1| uncharacterized protein LOC101755438 [Setari... 66 4e-09 gb|EAZ01264.1| hypothetical protein OsI_23288 [Oryza sativa Indi... 66 4e-09 gb|PAN23799.1| hypothetical protein PAHAL_D01475 [Panicum hallii] 66 4e-09 ref|XP_008649161.1| uncharacterized protein LOC103629847 [Zea mays] 66 4e-09 >ref|XP_020267656.1| two-component response regulator ARR2-like [Asparagus officinalis] ref|XP_020267657.1| two-component response regulator ARR2-like [Asparagus officinalis] gb|ONK69027.1| uncharacterized protein A4U43_C05F18520 [Asparagus officinalis] Length = 448 Score = 73.2 bits (178), Expect = 1e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 266 TVRQYNRSKMPRMRWTPDLHRSFVLAVERLGGQE 165 TVRQYNRSKMPR+RWTPDLHRSFVLAVERLGGQE Sbjct: 87 TVRQYNRSKMPRLRWTPDLHRSFVLAVERLGGQE 120 >ref|XP_020097739.1| transcription factor LUX [Ananas comosus] Length = 150 Score = 65.1 bits (157), Expect = 6e-10 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -1 Query: 266 TVRQYNRSKMPRMRWTPDLHRSFVLAVERLGGQESK 159 +VRQY RSKMPR+RWTPDLH +FV AVERLGGQESK Sbjct: 106 SVRQYVRSKMPRLRWTPDLHLAFVHAVERLGGQESK 141 >ref|XP_002316821.1| myb family transcription factor family protein [Populus trichocarpa] gb|PNT12148.1| hypothetical protein POPTR_011G067200v3 [Populus trichocarpa] Length = 155 Score = 65.1 bits (157), Expect = 7e-10 Identities = 33/46 (71%), Positives = 37/46 (80%) Frame = -1 Query: 266 TVRQYNRSKMPRMRWTPDLHRSFVLAVERLGGQESKSFSPLLFNYL 129 TVRQY RSKMPR+RWTPDLH SFV AVERLGGQE K+ L+F + Sbjct: 79 TVRQYVRSKMPRLRWTPDLHLSFVHAVERLGGQE-KATPKLVFQLM 123 >gb|PKU70268.1| Putative Myb family transcription factor [Dendrobium catenatum] Length = 280 Score = 67.0 bits (162), Expect = 8e-10 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -1 Query: 263 VRQYNRSKMPRMRWTPDLHRSFVLAVERLGGQESKSFS 150 VRQYNRSK+PR+RWTPDLH FV A+ERLGGQ+S FS Sbjct: 10 VRQYNRSKVPRLRWTPDLHHCFVYAIERLGGQDSNVFS 47 >gb|PON42508.1| Homeodomain-like [Parasponia andersonii] Length = 95 Score = 63.2 bits (152), Expect = 1e-09 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = -1 Query: 266 TVRQYNRSKMPRMRWTPDLHRSFVLAVERLGGQESKS 156 +VR Y RSKMPR+RWTPDLH FV AVERLGGQESKS Sbjct: 58 SVRPYVRSKMPRLRWTPDLHFRFVHAVERLGGQESKS 94 >gb|PON93998.1| Homeodomain-like [Trema orientalis] Length = 96 Score = 63.2 bits (152), Expect = 1e-09 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = -1 Query: 266 TVRQYNRSKMPRMRWTPDLHRSFVLAVERLGGQESKS 156 +VR Y RSKMPR+RWTPDLH FV AVERLGGQESKS Sbjct: 59 SVRPYVRSKMPRLRWTPDLHFRFVHAVERLGGQESKS 95 >gb|OVA13616.1| SANT/Myb domain [Macleaya cordata] Length = 172 Score = 64.7 bits (156), Expect = 1e-09 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -1 Query: 266 TVRQYNRSKMPRMRWTPDLHRSFVLAVERLGGQE 165 TVRQY RSKMPR+RWTPDLH SFV AVERLGGQE Sbjct: 95 TVRQYVRSKMPRLRWTPDLHLSFVRAVERLGGQE 128 >gb|KDO77871.1| hypothetical protein CISIN_1g035517mg [Citrus sinensis] Length = 161 Score = 64.3 bits (155), Expect = 2e-09 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -1 Query: 266 TVRQYNRSKMPRMRWTPDLHRSFVLAVERLGGQE 165 TVRQY RSKMPR+RWTPDLH SFV AVERLGGQE Sbjct: 82 TVRQYVRSKMPRLRWTPDLHLSFVHAVERLGGQE 115 >gb|KQL10921.1| hypothetical protein SETIT_006312mg [Setaria italica] Length = 490 Score = 66.6 bits (161), Expect = 2e-09 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = -1 Query: 263 VRQYNRSKMPRMRWTPDLHRSFVLAVERLGGQESKSFSPLLFN 135 VRQYNRSK+PR+RWTPDLH +FV AVERLGGQE FSP+ F+ Sbjct: 106 VRQYNRSKLPRLRWTPDLHMAFVHAVERLGGQE--IFSPMGFH 146 >dbj|GAU41935.1| hypothetical protein TSUD_380400 [Trifolium subterraneum] Length = 78 Score = 61.6 bits (148), Expect = 2e-09 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 266 TVRQYNRSKMPRMRWTPDLHRSFVLAVERLGGQES 162 TVR Y RSKMPR+RWTPDLHR F AVERLGG+ES Sbjct: 43 TVRPYVRSKMPRLRWTPDLHRCFAHAVERLGGEES 77 >gb|OAY76265.1| putative Myb family transcription factor [Ananas comosus] Length = 455 Score = 65.9 bits (159), Expect = 4e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -1 Query: 266 TVRQYNRSKMPRMRWTPDLHRSFVLAVERLGGQE 165 +VRQYNRSKMPR+RWTPDLH SFV A+ERLGGQE Sbjct: 81 SVRQYNRSKMPRLRWTPDLHLSFVHAIERLGGQE 114 >gb|OAY83208.1| putative Myb family transcription factor [Ananas comosus] Length = 493 Score = 65.9 bits (159), Expect = 4e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -1 Query: 266 TVRQYNRSKMPRMRWTPDLHRSFVLAVERLGGQE 165 +VRQYNRSKMPR+RWTPDLH SFV A+ERLGGQE Sbjct: 81 SVRQYNRSKMPRLRWTPDLHLSFVHAIERLGGQE 114 >gb|KQL27938.1| hypothetical protein SETIT_016955mg [Setaria italica] Length = 507 Score = 65.9 bits (159), Expect = 4e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -1 Query: 266 TVRQYNRSKMPRMRWTPDLHRSFVLAVERLGGQE 165 TVRQYNRSK+PR+RWTPDLH +FV AVERLGGQE Sbjct: 109 TVRQYNRSKLPRLRWTPDLHMAFVHAVERLGGQE 142 >gb|PAN04932.1| hypothetical protein PAHAL_A00979 [Panicum hallii] Length = 509 Score = 65.9 bits (159), Expect = 4e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -1 Query: 266 TVRQYNRSKMPRMRWTPDLHRSFVLAVERLGGQE 165 TVRQYNRSK+PR+RWTPDLH +FV AVERLGGQE Sbjct: 109 TVRQYNRSKLPRLRWTPDLHMAFVHAVERLGGQE 142 >gb|PAN04931.1| hypothetical protein PAHAL_A00979 [Panicum hallii] Length = 511 Score = 65.9 bits (159), Expect = 4e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -1 Query: 266 TVRQYNRSKMPRMRWTPDLHRSFVLAVERLGGQE 165 TVRQYNRSK+PR+RWTPDLH +FV AVERLGGQE Sbjct: 109 TVRQYNRSKLPRLRWTPDLHMAFVHAVERLGGQE 142 >ref|XP_021304606.1| uncharacterized protein LOC8072684 [Sorghum bicolor] gb|KXG20138.1| hypothetical protein SORBI_3010G160900 [Sorghum bicolor] gb|OQU76531.1| hypothetical protein SORBI_3010G160900 [Sorghum bicolor] Length = 512 Score = 65.9 bits (159), Expect = 4e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -1 Query: 266 TVRQYNRSKMPRMRWTPDLHRSFVLAVERLGGQE 165 TVRQYNRSK+PR+RWTPDLH +FV AVERLGGQE Sbjct: 108 TVRQYNRSKLPRLRWTPDLHMAFVHAVERLGGQE 141 >ref|XP_004951340.1| uncharacterized protein LOC101755438 [Setaria italica] Length = 513 Score = 65.9 bits (159), Expect = 4e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -1 Query: 266 TVRQYNRSKMPRMRWTPDLHRSFVLAVERLGGQE 165 TVRQYNRSK+PR+RWTPDLH +FV AVERLGGQE Sbjct: 115 TVRQYNRSKLPRLRWTPDLHMAFVHAVERLGGQE 148 >gb|EAZ01264.1| hypothetical protein OsI_23288 [Oryza sativa Indica Group] Length = 513 Score = 65.9 bits (159), Expect = 4e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -1 Query: 266 TVRQYNRSKMPRMRWTPDLHRSFVLAVERLGGQE 165 TVRQYNRSK+PR+RWTPDLH +FV AVERLGGQE Sbjct: 86 TVRQYNRSKLPRLRWTPDLHMAFVHAVERLGGQE 119 >gb|PAN23799.1| hypothetical protein PAHAL_D01475 [Panicum hallii] Length = 532 Score = 65.9 bits (159), Expect = 4e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -1 Query: 266 TVRQYNRSKMPRMRWTPDLHRSFVLAVERLGGQE 165 TVRQYNRSK+PR+RWTPDLH +FV AVERLGGQE Sbjct: 110 TVRQYNRSKLPRLRWTPDLHMAFVHAVERLGGQE 143 >ref|XP_008649161.1| uncharacterized protein LOC103629847 [Zea mays] Length = 538 Score = 65.9 bits (159), Expect = 4e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -1 Query: 266 TVRQYNRSKMPRMRWTPDLHRSFVLAVERLGGQE 165 TVRQYNRSK+PR+RWTPDLH +FV AVERLGGQE Sbjct: 114 TVRQYNRSKLPRLRWTPDLHMAFVHAVERLGGQE 147