BLASTX nr result
ID: Ophiopogon27_contig00004673
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00004673 (1327 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020244601.1| thioredoxin-like protein CXXS1 [Asparagus of... 57 2e-06 >ref|XP_020244601.1| thioredoxin-like protein CXXS1 [Asparagus officinalis] Length = 123 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 53 QENSSKVFRVDSKESWESIIAQANNQGCPV 142 QEN+SKV RVDSKE+WES IAQ+NNQGCPV Sbjct: 5 QENNSKVLRVDSKEAWESFIAQSNNQGCPV 34