BLASTX nr result
ID: Ophiopogon27_contig00004622
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00004622 (1073 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN70669.1| hypothetical protein VITISV_037506 [Vitis vinifera] 60 4e-06 >emb|CAN70669.1| hypothetical protein VITISV_037506 [Vitis vinifera] Length = 2825 Score = 60.5 bits (145), Expect = 4e-06 Identities = 28/53 (52%), Positives = 36/53 (67%) Frame = +2 Query: 896 CLRMKIISWNVRGLGCPDKRRSIRSFLSLNKVDILLLQETKLERFSARMAYSV 1054 C MKIISWNVRGLG +KRR ++ FL L D++++QETK E+ R SV Sbjct: 618 CFSMKIISWNVRGLGSRNKRRVVKDFLRLENPDVVMIQETKKEKCDRRFVGSV 670