BLASTX nr result
ID: Ophiopogon27_contig00004558
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00004558 (640 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017696016.1| PREDICTED: probable receptor-like protein ki... 59 9e-07 ref|XP_008776800.1| PREDICTED: probable receptor-like protein ki... 59 9e-07 >ref|XP_017696016.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform X2 [Phoenix dactylifera] Length = 387 Score = 59.3 bits (142), Expect = 9e-07 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = -1 Query: 640 SEETKKKRLNWKERAGDFKMGEGRRLAWFGWRPKLMRTH 524 SEE+KK+ L+WK R GD K+GEGR L W GW KL+RTH Sbjct: 349 SEESKKRGLDWKRRIGDLKVGEGRWLVWQGWTQKLVRTH 387 >ref|XP_008776800.1| PREDICTED: probable receptor-like protein kinase At5g47070 isoform X1 [Phoenix dactylifera] Length = 428 Score = 59.3 bits (142), Expect = 9e-07 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = -1 Query: 640 SEETKKKRLNWKERAGDFKMGEGRRLAWFGWRPKLMRTH 524 SEE+KK+ L+WK R GD K+GEGR L W GW KL+RTH Sbjct: 390 SEESKKRGLDWKRRIGDLKVGEGRWLVWQGWTQKLVRTH 428