BLASTX nr result
ID: Ophiopogon27_contig00004131
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00004131 (482 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020254592.1| protein CPR-5 [Asparagus officinalis] >gi|11... 57 1e-06 >ref|XP_020254592.1| protein CPR-5 [Asparagus officinalis] gb|ONK78443.1| uncharacterized protein A4U43_C02F18840 [Asparagus officinalis] Length = 567 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = -3 Query: 480 IIYPALCGLLPFASLGYWKGHFSEKIYHLVFGVEIQD 370 +IYPAL GLLPFASLG WK HF ++I HL+ GVE Q+ Sbjct: 531 VIYPALSGLLPFASLGDWKEHFLQRINHLIIGVESQE 567