BLASTX nr result
ID: Ophiopogon27_contig00003555
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00003555 (423 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020248987.1| lipid transfer-like protein VAS isoform X1 [... 62 2e-09 >ref|XP_020248987.1| lipid transfer-like protein VAS isoform X1 [Asparagus officinalis] ref|XP_020248988.1| lipid transfer-like protein VAS isoform X2 [Asparagus officinalis] ref|XP_020248989.1| lipid transfer-like protein VAS isoform X3 [Asparagus officinalis] gb|ONK55852.1| uncharacterized protein A4U43_C10F1630 [Asparagus officinalis] Length = 150 Score = 62.0 bits (149), Expect = 2e-09 Identities = 30/65 (46%), Positives = 34/65 (52%), Gaps = 1/65 (1%) Frame = +3 Query: 3 QLPKHCGMPSFSTNITC-NXXXXXXXXXXXXXXXXXXXXXXXHSTTWIGLSGLVSVVLFW 179 QLPK CGMPSFS NI C N HST W GLSGL ++ LFW Sbjct: 86 QLPKRCGMPSFSNNIACVNSTAGAPGHSMVPPATPGDNSNAEHSTNWFGLSGLAAISLFW 145 Query: 180 WSIMA 194 WS++A Sbjct: 146 WSLIA 150