BLASTX nr result
ID: Ophiopogon27_contig00003476
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00003476 (423 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020273375.1| ubiquitin carboxyl-terminal hydrolase 24 [As... 60 1e-07 ref|XP_008775014.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 55 4e-06 ref|XP_010938651.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 54 1e-05 >ref|XP_020273375.1| ubiquitin carboxyl-terminal hydrolase 24 [Asparagus officinalis] gb|ONK63490.1| uncharacterized protein A4U43_C07F15690 [Asparagus officinalis] Length = 558 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -3 Query: 115 MSDHKVFIFGSFTEDETRLFQSQSAQKSHVRPLEKTG 5 MSD +VFIFGSFTEDET+LFQSQSAQKS P EK G Sbjct: 1 MSDQQVFIFGSFTEDETKLFQSQSAQKSRKPPSEKNG 37 >ref|XP_008775014.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 24-like isoform X1 [Phoenix dactylifera] Length = 540 Score = 55.5 bits (132), Expect = 4e-06 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = -3 Query: 115 MSDHKVFIFGSFTEDETRLFQSQSAQKSHVRPLEKTG 5 MSDHKV IFGSFTEDETRLFQ Q + S+V PLEK G Sbjct: 1 MSDHKVLIFGSFTEDETRLFQRQLVE-SNVHPLEKAG 36 >ref|XP_010938651.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 24 isoform X2 [Elaeis guineensis] Length = 541 Score = 54.3 bits (129), Expect = 1e-05 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -3 Query: 115 MSDHKVFIFGSFTEDETRLFQSQSAQKSHVRPLEKTGS 2 MSDHKV +FGSFTEDETR FQSQ + ++VRPLEK S Sbjct: 1 MSDHKVLLFGSFTEDETRFFQSQLVE-NNVRPLEKARS 37