BLASTX nr result
ID: Ophiopogon27_contig00003296
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00003296 (431 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020267008.1| probable E3 ubiquitin ligase SUD1 [Asparagus... 70 5e-11 ref|XP_020250505.1| probable E3 ubiquitin ligase SUD1 isoform X2... 66 8e-10 ref|XP_020250504.1| probable E3 ubiquitin ligase SUD1 isoform X1... 66 8e-10 gb|KMZ68994.1| putative E3 ubiquitin ligase SUD1 [Zostera marina] 65 3e-09 ref|XP_015892861.1| PREDICTED: probable E3 ubiquitin ligase SUD1... 65 3e-09 gb|PHT41786.1| putative E3 ubiquitin ligase SUD1 [Capsicum bacca... 63 1e-08 ref|XP_016539545.1| PREDICTED: probable E3 ubiquitin ligase SUD1... 63 1e-08 gb|PHU10442.1| putative E3 ubiquitin ligase SUD1 [Capsicum chine... 63 1e-08 ref|XP_016539544.1| PREDICTED: probable E3 ubiquitin ligase SUD1... 63 1e-08 gb|KZM90625.1| hypothetical protein DCAR_022010 [Daucus carota s... 62 2e-08 ref|XP_017256136.1| PREDICTED: probable E3 ubiquitin ligase SUD1... 62 2e-08 ref|XP_017256135.1| PREDICTED: probable E3 ubiquitin ligase SUD1... 62 2e-08 ref|XP_019445805.1| PREDICTED: probable E3 ubiquitin ligase SUD1... 62 2e-08 ref|XP_019445804.1| PREDICTED: probable E3 ubiquitin ligase SUD1... 62 2e-08 ref|XP_018450406.1| PREDICTED: probable E3 ubiquitin ligase SUD1... 62 3e-08 ref|XP_018450405.1| PREDICTED: probable E3 ubiquitin ligase SUD1... 62 3e-08 ref|XP_010531564.1| PREDICTED: probable E3 ubiquitin ligase SUD1... 62 3e-08 ref|XP_010906555.2| PREDICTED: LOW QUALITY PROTEIN: probable E3 ... 62 3e-08 gb|OWM79209.1| hypothetical protein CDL15_Pgr003381 [Punica gran... 62 3e-08 ref|XP_009418267.1| PREDICTED: probable E3 ubiquitin ligase SUD1... 62 3e-08 >ref|XP_020267008.1| probable E3 ubiquitin ligase SUD1 [Asparagus officinalis] Length = 1102 Score = 69.7 bits (169), Expect = 5e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +2 Query: 341 QIRYDDDEDEGDVCRICRNPGDPDNPLRYP 430 QIRYDDDEDEGDVCRICRNPGD DNPLRYP Sbjct: 28 QIRYDDDEDEGDVCRICRNPGDSDNPLRYP 57 >ref|XP_020250505.1| probable E3 ubiquitin ligase SUD1 isoform X2 [Asparagus officinalis] Length = 1105 Score = 66.2 bits (160), Expect = 8e-10 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +2 Query: 341 QIRYDDDEDEGDVCRICRNPGDPDNPLRYP 430 QIR+DDD+DEGDVCRICRNP +PDNPLRYP Sbjct: 30 QIRFDDDDDEGDVCRICRNPAEPDNPLRYP 59 >ref|XP_020250504.1| probable E3 ubiquitin ligase SUD1 isoform X1 [Asparagus officinalis] gb|ONK55043.1| uncharacterized protein A4U43_UnF8260 [Asparagus officinalis] Length = 1117 Score = 66.2 bits (160), Expect = 8e-10 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +2 Query: 341 QIRYDDDEDEGDVCRICRNPGDPDNPLRYP 430 QIR+DDD+DEGDVCRICRNP +PDNPLRYP Sbjct: 30 QIRFDDDDDEGDVCRICRNPAEPDNPLRYP 59 >gb|KMZ68994.1| putative E3 ubiquitin ligase SUD1 [Zostera marina] Length = 1080 Score = 64.7 bits (156), Expect = 3e-09 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +2 Query: 347 RYDDDEDEGDVCRICRNPGDPDNPLRYP 430 RYD+DEDEGDVCRICRNPGD DNPLRYP Sbjct: 29 RYDEDEDEGDVCRICRNPGDSDNPLRYP 56 >ref|XP_015892861.1| PREDICTED: probable E3 ubiquitin ligase SUD1 [Ziziphus jujuba] Length = 1121 Score = 64.7 bits (156), Expect = 3e-09 Identities = 24/29 (82%), Positives = 29/29 (100%) Frame = +2 Query: 344 IRYDDDEDEGDVCRICRNPGDPDNPLRYP 430 ++YD++EDEGDVCRICRNPGDP+NPLRYP Sbjct: 61 VKYDEEEDEGDVCRICRNPGDPENPLRYP 89 >gb|PHT41786.1| putative E3 ubiquitin ligase SUD1 [Capsicum baccatum] Length = 1111 Score = 62.8 bits (151), Expect = 1e-08 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +2 Query: 350 YDDDEDEGDVCRICRNPGDPDNPLRYP 430 YDDDEDE DVCRICRNPG+PDNPLRYP Sbjct: 60 YDDDEDEEDVCRICRNPGEPDNPLRYP 86 >ref|XP_016539545.1| PREDICTED: probable E3 ubiquitin ligase SUD1 isoform X2 [Capsicum annuum] Length = 1111 Score = 62.8 bits (151), Expect = 1e-08 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +2 Query: 350 YDDDEDEGDVCRICRNPGDPDNPLRYP 430 YDDDEDE DVCRICRNPG+PDNPLRYP Sbjct: 60 YDDDEDEEDVCRICRNPGEPDNPLRYP 86 >gb|PHU10442.1| putative E3 ubiquitin ligase SUD1 [Capsicum chinense] Length = 1112 Score = 62.8 bits (151), Expect = 1e-08 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +2 Query: 350 YDDDEDEGDVCRICRNPGDPDNPLRYP 430 YDDDEDE DVCRICRNPG+PDNPLRYP Sbjct: 60 YDDDEDEEDVCRICRNPGEPDNPLRYP 86 >ref|XP_016539544.1| PREDICTED: probable E3 ubiquitin ligase SUD1 isoform X1 [Capsicum annuum] Length = 1112 Score = 62.8 bits (151), Expect = 1e-08 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +2 Query: 350 YDDDEDEGDVCRICRNPGDPDNPLRYP 430 YDDDEDE DVCRICRNPG+PDNPLRYP Sbjct: 60 YDDDEDEEDVCRICRNPGEPDNPLRYP 86 >gb|KZM90625.1| hypothetical protein DCAR_022010 [Daucus carota subsp. sativus] Length = 1100 Score = 62.0 bits (149), Expect = 2e-08 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +2 Query: 347 RYDDDEDEGDVCRICRNPGDPDNPLRYP 430 R+DDD++EGDVCRICRNPGD DNPLRYP Sbjct: 57 RFDDDDEEGDVCRICRNPGDADNPLRYP 84 >ref|XP_017256136.1| PREDICTED: probable E3 ubiquitin ligase SUD1 isoform X2 [Daucus carota subsp. sativus] Length = 1115 Score = 62.0 bits (149), Expect = 2e-08 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +2 Query: 347 RYDDDEDEGDVCRICRNPGDPDNPLRYP 430 R+DDD++EGDVCRICRNPGD DNPLRYP Sbjct: 57 RFDDDDEEGDVCRICRNPGDADNPLRYP 84 >ref|XP_017256135.1| PREDICTED: probable E3 ubiquitin ligase SUD1 isoform X1 [Daucus carota subsp. sativus] Length = 1116 Score = 62.0 bits (149), Expect = 2e-08 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +2 Query: 347 RYDDDEDEGDVCRICRNPGDPDNPLRYP 430 R+DDD++EGDVCRICRNPGD DNPLRYP Sbjct: 57 RFDDDDEEGDVCRICRNPGDADNPLRYP 84 >ref|XP_019445805.1| PREDICTED: probable E3 ubiquitin ligase SUD1 isoform X2 [Lupinus angustifolius] gb|OIW10194.1| hypothetical protein TanjilG_27945 [Lupinus angustifolius] Length = 1122 Score = 62.0 bits (149), Expect = 2e-08 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = +2 Query: 344 IRYDDDEDEGDVCRICRNPGDPDNPLRYP 430 ++YDDD++EGDVCRICRNPG+ DNPLRYP Sbjct: 65 VKYDDDDEEGDVCRICRNPGEADNPLRYP 93 >ref|XP_019445804.1| PREDICTED: probable E3 ubiquitin ligase SUD1 isoform X1 [Lupinus angustifolius] Length = 1123 Score = 62.0 bits (149), Expect = 2e-08 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = +2 Query: 344 IRYDDDEDEGDVCRICRNPGDPDNPLRYP 430 ++YDDD++EGDVCRICRNPG+ DNPLRYP Sbjct: 65 VKYDDDDEEGDVCRICRNPGEADNPLRYP 93 >ref|XP_018450406.1| PREDICTED: probable E3 ubiquitin ligase SUD1 isoform X2 [Raphanus sativus] Length = 1060 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +2 Query: 353 DDDEDEGDVCRICRNPGDPDNPLRYP 430 DDDEDEGDVCRICRNPGD DNPLRYP Sbjct: 52 DDDEDEGDVCRICRNPGDADNPLRYP 77 >ref|XP_018450405.1| PREDICTED: probable E3 ubiquitin ligase SUD1 isoform X1 [Raphanus sativus] Length = 1061 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +2 Query: 353 DDDEDEGDVCRICRNPGDPDNPLRYP 430 DDDEDEGDVCRICRNPGD DNPLRYP Sbjct: 52 DDDEDEGDVCRICRNPGDADNPLRYP 77 >ref|XP_010531564.1| PREDICTED: probable E3 ubiquitin ligase SUD1 [Tarenaya hassleriana] Length = 1088 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +2 Query: 353 DDDEDEGDVCRICRNPGDPDNPLRYP 430 DDDEDE DVCRICRNPGDPDNPLRYP Sbjct: 61 DDDEDEEDVCRICRNPGDPDNPLRYP 86 >ref|XP_010906555.2| PREDICTED: LOW QUALITY PROTEIN: probable E3 ubiquitin ligase SUD1 [Elaeis guineensis] Length = 1103 Score = 61.6 bits (148), Expect = 3e-08 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +2 Query: 347 RYDDDEDEGDVCRICRNPGDPDNPLRYP 430 R+DD+EDEGDVCRICRNPGD +NPLRYP Sbjct: 33 RFDDEEDEGDVCRICRNPGDAENPLRYP 60 >gb|OWM79209.1| hypothetical protein CDL15_Pgr003381 [Punica granatum] Length = 1107 Score = 61.6 bits (148), Expect = 3e-08 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +2 Query: 347 RYDDDEDEGDVCRICRNPGDPDNPLRYP 430 R+DDDE+EGDVCRICRNPGD +NPLRYP Sbjct: 47 RFDDDEEEGDVCRICRNPGDAENPLRYP 74 >ref|XP_009418267.1| PREDICTED: probable E3 ubiquitin ligase SUD1 [Musa acuminata subsp. malaccensis] Length = 1119 Score = 61.6 bits (148), Expect = 3e-08 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +2 Query: 350 YDDDEDEGDVCRICRNPGDPDNPLRYP 430 YDDD++EGDVCRICRNPGD DNPLRYP Sbjct: 55 YDDDDEEGDVCRICRNPGDADNPLRYP 81