BLASTX nr result
ID: Ophiopogon27_contig00003187
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00003187 (708 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_080489310.1| MULTISPECIES: hypothetical protein [Enteroco... 57 4e-07 gb|EJM97637.1| acyl-CoA dehydrogenase, partial [Herbaspirillum s... 54 6e-06 ref|WP_073981337.1| hypothetical protein [Enterococcus faecium] 53 7e-06 >ref|WP_080489310.1| MULTISPECIES: hypothetical protein [Enterococcus] Length = 80 Score = 56.6 bits (135), Expect = 4e-07 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +3 Query: 3 FFLMIRRPPRSTLFPYTTLFRSRDGLLEQYEDSV 104 FFLMIRRPPRSTLFPYTTLFRS++ LL+++ D + Sbjct: 13 FFLMIRRPPRSTLFPYTTLFRSQNVLLDEHIDKI 46 >gb|EJM97637.1| acyl-CoA dehydrogenase, partial [Herbaspirillum sp. YR522] Length = 118 Score = 54.3 bits (129), Expect = 6e-06 Identities = 27/33 (81%), Positives = 29/33 (87%), Gaps = 2/33 (6%) Frame = +3 Query: 3 FFLMIRRPPRSTLFPYTTLFRSR--DGLLEQYE 95 FFLMIRRPPRSTLFPYTTLFRSR D LL ++E Sbjct: 1 FFLMIRRPPRSTLFPYTTLFRSRAYDALLARHE 33 >ref|WP_073981337.1| hypothetical protein [Enterococcus faecium] Length = 82 Score = 53.1 bits (126), Expect = 7e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -2 Query: 95 FILL*KTISRSEERRVGKECRSRWSPYH*KK 3 F LL ++ RSEERRVGKECRSRWSPYH KK Sbjct: 36 FFLLLASMQRSEERRVGKECRSRWSPYHGKK 66