BLASTX nr result
ID: Ophiopogon27_contig00003149
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00003149 (552 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK81892.1| uncharacterized protein A4U43_C01F33930 [Asparagu... 77 4e-13 ref|XP_020265939.1| protein AIR1 [Asparagus officinalis] 77 4e-13 >gb|ONK81892.1| uncharacterized protein A4U43_C01F33930 [Asparagus officinalis] Length = 415 Score = 77.0 bits (188), Expect = 4e-13 Identities = 38/60 (63%), Positives = 44/60 (73%), Gaps = 3/60 (5%) Frame = +3 Query: 3 KVYSTPSGGHYSTPQSPFKKHKPFAGTPYSNASS---SSNHPGYSTPGYYGRSQGYYERT 173 K YS S G+YSTPQSPF K K F GTP S+A+S S + GYSTP +YGRSQGYY+RT Sbjct: 356 KSYSKTSSGYYSTPQSPFSKQKSFMGTPNSHAASRHHSRHSNGYSTPRHYGRSQGYYDRT 415 >ref|XP_020265939.1| protein AIR1 [Asparagus officinalis] Length = 486 Score = 77.0 bits (188), Expect = 4e-13 Identities = 38/60 (63%), Positives = 44/60 (73%), Gaps = 3/60 (5%) Frame = +3 Query: 3 KVYSTPSGGHYSTPQSPFKKHKPFAGTPYSNASS---SSNHPGYSTPGYYGRSQGYYERT 173 K YS S G+YSTPQSPF K K F GTP S+A+S S + GYSTP +YGRSQGYY+RT Sbjct: 427 KSYSKTSSGYYSTPQSPFSKQKSFMGTPNSHAASRHHSRHSNGYSTPRHYGRSQGYYDRT 486