BLASTX nr result
ID: Ophiopogon27_contig00002940
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00002940 (422 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023913213.1| nicotinamide adenine dinucleotide transporte... 82 1e-15 ref|XP_022954234.1| nicotinamide adenine dinucleotide transporte... 81 2e-15 gb|POF09564.1| nicotinamide adenine dinucleotide transporter 1, ... 82 2e-15 ref|XP_008451527.1| PREDICTED: LOW QUALITY PROTEIN: nicotinamide... 80 3e-15 gb|OMO82035.1| Mitochondrial carrier protein [Corchorus olitorius] 80 6e-15 gb|OMO63910.1| Endoplasmic reticulum-adenine nucleotide transpor... 80 6e-15 ref|XP_011659376.1| PREDICTED: nicotinamide adenine dinucleotide... 79 1e-14 ref|XP_004136010.1| PREDICTED: nicotinamide adenine dinucleotide... 79 1e-14 ref|XP_009414905.1| PREDICTED: nicotinamide adenine dinucleotide... 79 2e-14 ref|XP_016565814.1| PREDICTED: nicotinamide adenine dinucleotide... 79 2e-14 ref|XP_009414904.1| PREDICTED: nicotinamide adenine dinucleotide... 79 2e-14 gb|PHU10795.1| Nicotinamide adenine dinucleotide transporter 1, ... 79 2e-14 ref|XP_016565813.1| PREDICTED: nicotinamide adenine dinucleotide... 79 2e-14 ref|XP_012082829.1| nicotinamide adenine dinucleotide transporte... 78 2e-14 ref|XP_021656072.1| nicotinamide adenine dinucleotide transporte... 78 2e-14 ref|XP_021672831.1| nicotinamide adenine dinucleotide transporte... 78 2e-14 ref|XP_002273574.1| PREDICTED: nicotinamide adenine dinucleotide... 78 2e-14 ref|XP_010326568.1| PREDICTED: nicotinamide adenine dinucleotide... 77 4e-14 ref|XP_021281144.1| nicotinamide adenine dinucleotide transporte... 77 4e-14 ref|XP_006359875.1| PREDICTED: nicotinamide adenine dinucleotide... 77 4e-14 >ref|XP_023913213.1| nicotinamide adenine dinucleotide transporter 1, chloroplastic [Quercus suber] Length = 315 Score = 81.6 bits (200), Expect = 1e-15 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -1 Query: 422 CATNLLRTTPAAAITFTSFEMIHRFLINVFPPKPHPHTL 306 CATNLLRTTPAA ITFTSFEMIHRFL+NVFPP PHPHTL Sbjct: 277 CATNLLRTTPAAVITFTSFEMIHRFLVNVFPPDPHPHTL 315 >ref|XP_022954234.1| nicotinamide adenine dinucleotide transporter 1, chloroplastic-like [Cucurbita moschata] ref|XP_022991235.1| nicotinamide adenine dinucleotide transporter 1, chloroplastic-like [Cucurbita maxima] ref|XP_023549290.1| nicotinamide adenine dinucleotide transporter 1, chloroplastic-like [Cucurbita pepo subsp. pepo] Length = 311 Score = 81.3 bits (199), Expect = 2e-15 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -1 Query: 422 CATNLLRTTPAAAITFTSFEMIHRFLINVFPPKPHPHTL 306 CATNL+RTTPAAAITFTSFEMIHRFL+N+FPP PHPHTL Sbjct: 273 CATNLIRTTPAAAITFTSFEMIHRFLVNLFPPDPHPHTL 311 >gb|POF09564.1| nicotinamide adenine dinucleotide transporter 1, chloroplastic [Quercus suber] Length = 418 Score = 81.6 bits (200), Expect = 2e-15 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -1 Query: 422 CATNLLRTTPAAAITFTSFEMIHRFLINVFPPKPHPHTL 306 CATNLLRTTPAA ITFTSFEMIHRFL+NVFPP PHPHTL Sbjct: 380 CATNLLRTTPAAVITFTSFEMIHRFLVNVFPPDPHPHTL 418 >ref|XP_008451527.1| PREDICTED: LOW QUALITY PROTEIN: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like [Cucumis melo] Length = 311 Score = 80.5 bits (197), Expect = 3e-15 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -1 Query: 422 CATNLLRTTPAAAITFTSFEMIHRFLINVFPPKPHPHTL 306 CATNLLRTTPAA ITFTSFEMIHRFL+N+FPP PHPHTL Sbjct: 273 CATNLLRTTPAAVITFTSFEMIHRFLVNLFPPDPHPHTL 311 >gb|OMO82035.1| Mitochondrial carrier protein [Corchorus olitorius] Length = 315 Score = 79.7 bits (195), Expect = 6e-15 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -1 Query: 422 CATNLLRTTPAAAITFTSFEMIHRFLINVFPPKPHPHTL 306 CATNL+RTTPAA ITFTSFEMIHRFL+N+FPP PHPHTL Sbjct: 277 CATNLIRTTPAAVITFTSFEMIHRFLVNLFPPDPHPHTL 315 >gb|OMO63910.1| Endoplasmic reticulum-adenine nucleotide transporter [Corchorus capsularis] Length = 315 Score = 79.7 bits (195), Expect = 6e-15 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -1 Query: 422 CATNLLRTTPAAAITFTSFEMIHRFLINVFPPKPHPHTL 306 CATNL+RTTPAA ITFTSFEMIHRFL+N+FPP PHPHTL Sbjct: 277 CATNLIRTTPAAVITFTSFEMIHRFLVNLFPPDPHPHTL 315 >ref|XP_011659376.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic isoform X2 [Cucumis sativus] Length = 303 Score = 79.0 bits (193), Expect = 1e-14 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = -1 Query: 422 CATNLLRTTPAAAITFTSFEMIHRFLINVFPPKPHPHTL 306 CATNLLRTTPAA ITFTSFEMIHRFL N+FPP PHPHTL Sbjct: 265 CATNLLRTTPAAVITFTSFEMIHRFLANLFPPDPHPHTL 303 >ref|XP_004136010.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic isoform X1 [Cucumis sativus] gb|KGN44980.1| hypothetical protein Csa_7G405860 [Cucumis sativus] Length = 311 Score = 79.0 bits (193), Expect = 1e-14 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = -1 Query: 422 CATNLLRTTPAAAITFTSFEMIHRFLINVFPPKPHPHTL 306 CATNLLRTTPAA ITFTSFEMIHRFL N+FPP PHPHTL Sbjct: 273 CATNLLRTTPAAVITFTSFEMIHRFLANLFPPDPHPHTL 311 >ref|XP_009414905.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 315 Score = 78.6 bits (192), Expect = 2e-14 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -1 Query: 422 CATNLLRTTPAAAITFTSFEMIHRFLINVFPPKPHPHTL 306 CATNLLRTTPAA ITFTSFEMIHRFLIN+FPP+ HPHTL Sbjct: 277 CATNLLRTTPAAVITFTSFEMIHRFLINLFPPESHPHTL 315 >ref|XP_016565814.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic isoform X2 [Capsicum annuum] gb|PHT38753.1| Nicotinamide adenine dinucleotide transporter 1, chloroplastic [Capsicum baccatum] Length = 316 Score = 78.6 bits (192), Expect = 2e-14 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -1 Query: 422 CATNLLRTTPAAAITFTSFEMIHRFLINVFPPKPHPHTL 306 CATNL+RTTPAA ITFTSFEMIHRFL+ VFPP PHPHTL Sbjct: 278 CATNLIRTTPAAVITFTSFEMIHRFLVTVFPPDPHPHTL 316 >ref|XP_009414904.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 316 Score = 78.6 bits (192), Expect = 2e-14 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -1 Query: 422 CATNLLRTTPAAAITFTSFEMIHRFLINVFPPKPHPHTL 306 CATNLLRTTPAA ITFTSFEMIHRFLIN+FPP+ HPHTL Sbjct: 278 CATNLLRTTPAAVITFTSFEMIHRFLINLFPPESHPHTL 316 >gb|PHU10795.1| Nicotinamide adenine dinucleotide transporter 1, chloroplastic [Capsicum chinense] Length = 317 Score = 78.6 bits (192), Expect = 2e-14 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -1 Query: 422 CATNLLRTTPAAAITFTSFEMIHRFLINVFPPKPHPHTL 306 CATNL+RTTPAA ITFTSFEMIHRFL+ VFPP PHPHTL Sbjct: 279 CATNLIRTTPAAVITFTSFEMIHRFLVTVFPPDPHPHTL 317 >ref|XP_016565813.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic isoform X1 [Capsicum annuum] gb|PHT86005.1| Nicotinamide adenine dinucleotide transporter 1, chloroplastic [Capsicum annuum] Length = 317 Score = 78.6 bits (192), Expect = 2e-14 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -1 Query: 422 CATNLLRTTPAAAITFTSFEMIHRFLINVFPPKPHPHTL 306 CATNL+RTTPAA ITFTSFEMIHRFL+ VFPP PHPHTL Sbjct: 279 CATNLIRTTPAAVITFTSFEMIHRFLVTVFPPDPHPHTL 317 >ref|XP_012082829.1| nicotinamide adenine dinucleotide transporter 1, chloroplastic [Jatropha curcas] gb|KDP28207.1| hypothetical protein JCGZ_13978 [Jatropha curcas] Length = 312 Score = 78.2 bits (191), Expect = 2e-14 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -1 Query: 422 CATNLLRTTPAAAITFTSFEMIHRFLINVFPPKPHPHTL 306 CATNLLRTTPAA ITFTSFEMIHRFL+ +FPP PHPHTL Sbjct: 274 CATNLLRTTPAAVITFTSFEMIHRFLVTLFPPDPHPHTL 312 >ref|XP_021656072.1| nicotinamide adenine dinucleotide transporter 1, chloroplastic-like [Hevea brasiliensis] Length = 314 Score = 78.2 bits (191), Expect = 2e-14 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -1 Query: 422 CATNLLRTTPAAAITFTSFEMIHRFLINVFPPKPHPHTL 306 CATNLLRTTPAA ITFTSFEMIHRFL+ +FPP PHPHTL Sbjct: 276 CATNLLRTTPAAVITFTSFEMIHRFLVTLFPPDPHPHTL 314 >ref|XP_021672831.1| nicotinamide adenine dinucleotide transporter 1, chloroplastic-like [Hevea brasiliensis] Length = 314 Score = 78.2 bits (191), Expect = 2e-14 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -1 Query: 422 CATNLLRTTPAAAITFTSFEMIHRFLINVFPPKPHPHTL 306 CATNLLRTTPAA ITFTSFEMIHRFL+ +FPP PHPHTL Sbjct: 276 CATNLLRTTPAAVITFTSFEMIHRFLVTLFPPDPHPHTL 314 >ref|XP_002273574.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic isoform X1 [Vitis vinifera] emb|CBI36905.3| unnamed protein product, partial [Vitis vinifera] Length = 315 Score = 78.2 bits (191), Expect = 2e-14 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -1 Query: 422 CATNLLRTTPAAAITFTSFEMIHRFLINVFPPKPHPHTL 306 CATNLLRTTPAA ITFTSFEMIHRFL+N+ PP PHPHTL Sbjct: 277 CATNLLRTTPAAVITFTSFEMIHRFLVNLLPPDPHPHTL 315 >ref|XP_010326568.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic [Solanum lycopersicum] Length = 313 Score = 77.4 bits (189), Expect = 4e-14 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 422 CATNLLRTTPAAAITFTSFEMIHRFLINVFPPKPHPHTL 306 CATNL+RTTPAA ITFTSFEMIHRFL+ +FPP PHPHTL Sbjct: 275 CATNLIRTTPAAVITFTSFEMIHRFLVTMFPPDPHPHTL 313 >ref|XP_021281144.1| nicotinamide adenine dinucleotide transporter 1, chloroplastic [Herrania umbratica] Length = 315 Score = 77.4 bits (189), Expect = 4e-14 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 422 CATNLLRTTPAAAITFTSFEMIHRFLINVFPPKPHPHTL 306 CATNL+RTTPAA ITFTSFEMIHRFL+N+FPP P PHTL Sbjct: 277 CATNLIRTTPAAVITFTSFEMIHRFLVNIFPPDPQPHTL 315 >ref|XP_006359875.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic [Solanum tuberosum] Length = 316 Score = 77.4 bits (189), Expect = 4e-14 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 422 CATNLLRTTPAAAITFTSFEMIHRFLINVFPPKPHPHTL 306 CATNL+RTTPAA ITFTSFEMIHRFL+ +FPP PHPHTL Sbjct: 278 CATNLIRTTPAAVITFTSFEMIHRFLVTMFPPDPHPHTL 316