BLASTX nr result
ID: Ophiopogon27_contig00002133
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00002133 (439 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_018455763.1| PREDICTED: 50S ribosomal protein L19-1, chlo... 63 8e-10 gb|ACF23041.1| ST10, partial [Eutrema halophilum] 63 8e-10 gb|PPR86930.1| hypothetical protein GOBAR_AA33763 [Gossypium bar... 64 8e-10 ref|XP_023873256.1| 50S ribosomal protein L19-1, chloroplastic, ... 62 8e-10 gb|KHN42660.1| 50S ribosomal protein L19, chloroplastic [Glycine... 62 1e-09 gb|ONK56324.1| uncharacterized protein A4U43_C10F6840 [Asparagus... 64 1e-09 ref|XP_020249127.1| 50S ribosomal protein L19-1, chloroplastic-l... 64 1e-09 ref|XP_008369232.1| PREDICTED: 50S ribosomal protein L19, chloro... 62 2e-09 ref|XP_019421814.1| PREDICTED: 50S ribosomal protein L19-1, chlo... 64 2e-09 ref|XP_019421813.1| PREDICTED: 50S ribosomal protein L19-1, chlo... 64 2e-09 gb|KJB20918.1| hypothetical protein B456_003G177300 [Gossypium r... 64 2e-09 ref|XP_012858948.1| PREDICTED: 50S ribosomal protein L19-1, chlo... 64 2e-09 pdb|5H1S|R Chain R, Structure Of The Large Subunit Of The Chloro... 62 2e-09 gb|KYP67121.1| hypothetical protein KK1_013444, partial [Cajanus... 63 2e-09 ref|XP_009413275.1| PREDICTED: 50S ribosomal protein L19, chloro... 64 2e-09 gb|KHG18581.1| hypothetical protein F383_08798 [Gossypium arboreum] 64 3e-09 ref|XP_022878594.1| 50S ribosomal protein L19-1, chloroplastic-l... 64 3e-09 emb|CAN82787.1| hypothetical protein VITISV_037813 [Vitis vinifera] 64 3e-09 ref|XP_002264869.2| PREDICTED: 50S ribosomal protein L19-2, chlo... 64 3e-09 gb|KZV50701.1| hypothetical protein F511_19613 [Dorcoceras hygro... 63 3e-09 >ref|XP_018455763.1| PREDICTED: 50S ribosomal protein L19-1, chloroplastic-like [Raphanus sativus] Length = 135 Score = 63.2 bits (152), Expect = 8e-10 Identities = 32/42 (76%), Positives = 33/42 (78%) Frame = -3 Query: 389 VEIVFPVYSPNIKEIXXXXXXXXXRARLYYLRDKLPRLSTFK 264 VEIVFP+YSPNIKEI RARLYYLRDKLPRLSTFK Sbjct: 94 VEIVFPIYSPNIKEIKVVSQRKVRRARLYYLRDKLPRLSTFK 135 >gb|ACF23041.1| ST10, partial [Eutrema halophilum] Length = 136 Score = 63.2 bits (152), Expect = 8e-10 Identities = 32/42 (76%), Positives = 33/42 (78%) Frame = -3 Query: 389 VEIVFPVYSPNIKEIXXXXXXXXXRARLYYLRDKLPRLSTFK 264 VEIVFP+YSPNIKEI RARLYYLRDKLPRLSTFK Sbjct: 95 VEIVFPIYSPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 136 >gb|PPR86930.1| hypothetical protein GOBAR_AA33763 [Gossypium barbadense] Length = 153 Score = 63.5 bits (153), Expect = 8e-10 Identities = 33/42 (78%), Positives = 33/42 (78%) Frame = -3 Query: 389 VEIVFPVYSPNIKEIXXXXXXXXXRARLYYLRDKLPRLSTFK 264 VEIVFPVYSPNIKEI RARLYYLRDKLPRLSTFK Sbjct: 112 VEIVFPVYSPNIKEIKVVKHRKVRRARLYYLRDKLPRLSTFK 153 >ref|XP_023873256.1| 50S ribosomal protein L19-1, chloroplastic, partial [Quercus suber] ref|XP_023899125.1| 50S ribosomal protein L19-1, chloroplastic, partial [Quercus suber] ref|XP_023924876.1| 50S ribosomal protein L19-1, chloroplastic, partial [Quercus suber] Length = 109 Score = 62.4 bits (150), Expect = 8e-10 Identities = 32/42 (76%), Positives = 33/42 (78%) Frame = -3 Query: 389 VEIVFPVYSPNIKEIXXXXXXXXXRARLYYLRDKLPRLSTFK 264 VEIVFP+YSPNIKEI RARLYYLRDKLPRLSTFK Sbjct: 68 VEIVFPLYSPNIKEIKVVKHRKVRRARLYYLRDKLPRLSTFK 109 >gb|KHN42660.1| 50S ribosomal protein L19, chloroplastic [Glycine soja] Length = 111 Score = 62.0 bits (149), Expect = 1e-09 Identities = 32/42 (76%), Positives = 32/42 (76%) Frame = -3 Query: 389 VEIVFPVYSPNIKEIXXXXXXXXXRARLYYLRDKLPRLSTFK 264 VEIVFPVYSPNIKEI RARLYYLRDKLPR STFK Sbjct: 70 VEIVFPVYSPNIKEIKVVSHRKVRRARLYYLRDKLPRFSTFK 111 >gb|ONK56324.1| uncharacterized protein A4U43_C10F6840 [Asparagus officinalis] Length = 179 Score = 63.5 bits (153), Expect = 1e-09 Identities = 33/42 (78%), Positives = 33/42 (78%) Frame = -3 Query: 389 VEIVFPVYSPNIKEIXXXXXXXXXRARLYYLRDKLPRLSTFK 264 VEIVFPVYSPNIKEI RARLYYLRDKLPRLSTFK Sbjct: 138 VEIVFPVYSPNIKEIKVVKHRKVRRARLYYLRDKLPRLSTFK 179 >ref|XP_020249127.1| 50S ribosomal protein L19-1, chloroplastic-like [Asparagus officinalis] Length = 189 Score = 63.5 bits (153), Expect = 1e-09 Identities = 33/42 (78%), Positives = 33/42 (78%) Frame = -3 Query: 389 VEIVFPVYSPNIKEIXXXXXXXXXRARLYYLRDKLPRLSTFK 264 VEIVFPVYSPNIKEI RARLYYLRDKLPRLSTFK Sbjct: 148 VEIVFPVYSPNIKEIKVVKHRKVRRARLYYLRDKLPRLSTFK 189 >ref|XP_008369232.1| PREDICTED: 50S ribosomal protein L19, chloroplastic-like [Malus domestica] Length = 114 Score = 61.6 bits (148), Expect = 2e-09 Identities = 31/42 (73%), Positives = 33/42 (78%) Frame = -3 Query: 389 VEIVFPVYSPNIKEIXXXXXXXXXRARLYYLRDKLPRLSTFK 264 VEIVFP+YSPNIKE+ RARLYYLRDKLPRLSTFK Sbjct: 73 VEIVFPLYSPNIKELKVLSHRKVRRARLYYLRDKLPRLSTFK 114 >ref|XP_019421814.1| PREDICTED: 50S ribosomal protein L19-1, chloroplastic-like isoform X2 [Lupinus angustifolius] Length = 212 Score = 63.5 bits (153), Expect = 2e-09 Identities = 33/42 (78%), Positives = 33/42 (78%) Frame = -3 Query: 389 VEIVFPVYSPNIKEIXXXXXXXXXRARLYYLRDKLPRLSTFK 264 VEIVFPVYSPNIKEI RARLYYLRDKLPRLSTFK Sbjct: 171 VEIVFPVYSPNIKEIKVVNHRKVRRARLYYLRDKLPRLSTFK 212 >ref|XP_019421813.1| PREDICTED: 50S ribosomal protein L19-1, chloroplastic-like isoform X1 [Lupinus angustifolius] gb|OIV94628.1| hypothetical protein TanjilG_25852 [Lupinus angustifolius] Length = 213 Score = 63.5 bits (153), Expect = 2e-09 Identities = 33/42 (78%), Positives = 33/42 (78%) Frame = -3 Query: 389 VEIVFPVYSPNIKEIXXXXXXXXXRARLYYLRDKLPRLSTFK 264 VEIVFPVYSPNIKEI RARLYYLRDKLPRLSTFK Sbjct: 172 VEIVFPVYSPNIKEIKVVNHRKVRRARLYYLRDKLPRLSTFK 213 >gb|KJB20918.1| hypothetical protein B456_003G177300 [Gossypium raimondii] Length = 215 Score = 63.5 bits (153), Expect = 2e-09 Identities = 33/42 (78%), Positives = 33/42 (78%) Frame = -3 Query: 389 VEIVFPVYSPNIKEIXXXXXXXXXRARLYYLRDKLPRLSTFK 264 VEIVFPVYSPNIKEI RARLYYLRDKLPRLSTFK Sbjct: 174 VEIVFPVYSPNIKEIKVVKHRKVRRARLYYLRDKLPRLSTFK 215 >ref|XP_012858948.1| PREDICTED: 50S ribosomal protein L19-1, chloroplastic [Erythranthe guttata] gb|EYU19455.1| hypothetical protein MIMGU_mgv1a013552mg [Erythranthe guttata] Length = 217 Score = 63.5 bits (153), Expect = 2e-09 Identities = 33/42 (78%), Positives = 33/42 (78%) Frame = -3 Query: 389 VEIVFPVYSPNIKEIXXXXXXXXXRARLYYLRDKLPRLSTFK 264 VEIVFPVYSPNIKEI RARLYYLRDKLPRLSTFK Sbjct: 176 VEIVFPVYSPNIKEIRVLSHRKVRRARLYYLRDKLPRLSTFK 217 >pdb|5H1S|R Chain R, Structure Of The Large Subunit Of The Chloro-ribosome pdb|5X8T|Q Chain Q, Structure Of The 50s Large Subunit Of Chloroplast Ribosome From Spinach Length = 156 Score = 62.4 bits (150), Expect = 2e-09 Identities = 31/42 (73%), Positives = 33/42 (78%) Frame = -3 Query: 389 VEIVFPVYSPNIKEIXXXXXXXXXRARLYYLRDKLPRLSTFK 264 VEIVFP+YSPNIKEI +ARLYYLRDKLPRLSTFK Sbjct: 115 VEIVFPLYSPNIKEIKVVSHRKVRKARLYYLRDKLPRLSTFK 156 >gb|KYP67121.1| hypothetical protein KK1_013444, partial [Cajanus cajan] Length = 196 Score = 63.2 bits (152), Expect = 2e-09 Identities = 32/42 (76%), Positives = 33/42 (78%) Frame = -3 Query: 389 VEIVFPVYSPNIKEIXXXXXXXXXRARLYYLRDKLPRLSTFK 264 VEIVFP+YSPNIKEI RARLYYLRDKLPRLSTFK Sbjct: 155 VEIVFPIYSPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 196 >ref|XP_009413275.1| PREDICTED: 50S ribosomal protein L19, chloroplastic [Musa acuminata subsp. malaccensis] Length = 226 Score = 63.5 bits (153), Expect = 2e-09 Identities = 33/42 (78%), Positives = 33/42 (78%) Frame = -3 Query: 389 VEIVFPVYSPNIKEIXXXXXXXXXRARLYYLRDKLPRLSTFK 264 VEIVFPVYSPNIKEI RARLYYLRDKLPRLSTFK Sbjct: 185 VEIVFPVYSPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 226 >gb|KHG18581.1| hypothetical protein F383_08798 [Gossypium arboreum] Length = 228 Score = 63.5 bits (153), Expect = 3e-09 Identities = 33/42 (78%), Positives = 33/42 (78%) Frame = -3 Query: 389 VEIVFPVYSPNIKEIXXXXXXXXXRARLYYLRDKLPRLSTFK 264 VEIVFPVYSPNIKEI RARLYYLRDKLPRLSTFK Sbjct: 187 VEIVFPVYSPNIKEIKVVKHRKVRRARLYYLRDKLPRLSTFK 228 >ref|XP_022878594.1| 50S ribosomal protein L19-1, chloroplastic-like [Olea europaea var. sylvestris] Length = 230 Score = 63.5 bits (153), Expect = 3e-09 Identities = 33/42 (78%), Positives = 33/42 (78%) Frame = -3 Query: 389 VEIVFPVYSPNIKEIXXXXXXXXXRARLYYLRDKLPRLSTFK 264 VEIVFPVYSPNIKEI RARLYYLRDKLPRLSTFK Sbjct: 189 VEIVFPVYSPNIKEIKVIKHRKVRRARLYYLRDKLPRLSTFK 230 >emb|CAN82787.1| hypothetical protein VITISV_037813 [Vitis vinifera] Length = 231 Score = 63.5 bits (153), Expect = 3e-09 Identities = 33/42 (78%), Positives = 33/42 (78%) Frame = -3 Query: 389 VEIVFPVYSPNIKEIXXXXXXXXXRARLYYLRDKLPRLSTFK 264 VEIVFPVYSPNIKEI RARLYYLRDKLPRLSTFK Sbjct: 190 VEIVFPVYSPNIKEIKVVNHRKVRRARLYYLRDKLPRLSTFK 231 >ref|XP_002264869.2| PREDICTED: 50S ribosomal protein L19-2, chloroplastic [Vitis vinifera] emb|CBI38456.3| unnamed protein product, partial [Vitis vinifera] Length = 231 Score = 63.5 bits (153), Expect = 3e-09 Identities = 33/42 (78%), Positives = 33/42 (78%) Frame = -3 Query: 389 VEIVFPVYSPNIKEIXXXXXXXXXRARLYYLRDKLPRLSTFK 264 VEIVFPVYSPNIKEI RARLYYLRDKLPRLSTFK Sbjct: 190 VEIVFPVYSPNIKEIKVVNHRKVRRARLYYLRDKLPRLSTFK 231 >gb|KZV50701.1| hypothetical protein F511_19613 [Dorcoceras hygrometricum] Length = 207 Score = 63.2 bits (152), Expect = 3e-09 Identities = 32/42 (76%), Positives = 33/42 (78%) Frame = -3 Query: 389 VEIVFPVYSPNIKEIXXXXXXXXXRARLYYLRDKLPRLSTFK 264 VEIVFP+YSPNIKEI RARLYYLRDKLPRLSTFK Sbjct: 166 VEIVFPIYSPNIKEIKVVKHRKVRRARLYYLRDKLPRLSTFK 207