BLASTX nr result
ID: Ophiopogon27_contig00001464
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00001464 (463 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAM08932.1| ubiquitin conjugating-like enzyme, partial [Malus... 71 8e-14 emb|CAA06493.1| Ubiquitin conjugating enzyme, partial [Cicer ari... 70 3e-13 dbj|BAF19636.2| Os06g0506600, partial [Oryza sativa Japonica Group] 70 4e-13 ref|XP_021726807.1| ubiquitin-conjugating enzyme E2 28-like isof... 71 5e-13 gb|ONM12403.1| Ubiquitin-conjugating enzyme E2 11 [Zea mays] >gi... 71 5e-13 gb|PKI39909.1| hypothetical protein CRG98_039698 [Punica granatum] 70 6e-13 ref|XP_022770534.1| ubiquitin-conjugating enzyme E2 28-like isof... 71 6e-13 ref|XP_016692914.1| PREDICTED: ubiquitin-conjugating enzyme E2 2... 71 6e-13 gb|POE79129.1| ubiquitin-conjugating enzyme e2-17 kda [Quercus s... 70 7e-13 ref|XP_020276641.1| ubiquitin-conjugating enzyme E2-17 kDa-like ... 71 7e-13 gb|ONM12406.1| Ubiquitin-conjugating enzyme E2 11 [Zea mays] 71 9e-13 gb|KDO64145.1| hypothetical protein CISIN_1g0337002mg, partial [... 69 9e-13 ref|XP_019701380.1| PREDICTED: ubiquitin-conjugating enzyme E2 2... 71 1e-12 gb|AAF24583.1|AC007764_25 F22C12.2 [Arabidopsis thaliana] 71 1e-12 gb|PPR85610.1| hypothetical protein GOBAR_AA35082 [Gossypium bar... 71 1e-12 gb|PON47206.1| Ubiquitin-fold modifier-conjugating enzyme [Paras... 71 1e-12 gb|PKA64238.1| Ubiquitin-conjugating enzyme E2 28 [Apostasia she... 71 1e-12 ref|XP_022770533.1| ubiquitin-conjugating enzyme E2 28-like isof... 71 1e-12 ref|XP_022757501.1| ubiquitin-conjugating enzyme E2 28 [Durio zi... 71 1e-12 gb|OVA08260.1| Ubiquitin-conjugating enzyme [Macleaya cordata] 71 1e-12 >gb|AAM08932.1| ubiquitin conjugating-like enzyme, partial [Malus domestica] Length = 42 Score = 71.2 bits (173), Expect = 8e-14 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 1 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 96 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG Sbjct: 11 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 42 >emb|CAA06493.1| Ubiquitin conjugating enzyme, partial [Cicer arietinum] Length = 61 Score = 70.1 bits (170), Expect = 3e-13 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 1 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 96 DPLVPEIAHMYKTDRAKYE+TARSWTQKYAMG Sbjct: 30 DPLVPEIAHMYKTDRAKYEATARSWTQKYAMG 61 >dbj|BAF19636.2| Os06g0506600, partial [Oryza sativa Japonica Group] Length = 51 Score = 69.7 bits (169), Expect = 4e-13 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +1 Query: 1 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 96 DPLVPEIAHMYKTDRAKYESTAR WTQKYAMG Sbjct: 20 DPLVPEIAHMYKTDRAKYESTARGWTQKYAMG 51 >ref|XP_021726807.1| ubiquitin-conjugating enzyme E2 28-like isoform X2 [Chenopodium quinoa] Length = 119 Score = 71.2 bits (173), Expect = 5e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 1 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 96 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG Sbjct: 88 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 119 >gb|ONM12403.1| Ubiquitin-conjugating enzyme E2 11 [Zea mays] gb|ONM12404.1| Ubiquitin-conjugating enzyme E2 11 [Zea mays] Length = 119 Score = 71.2 bits (173), Expect = 5e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 1 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 96 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG Sbjct: 88 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 119 >gb|PKI39909.1| hypothetical protein CRG98_039698 [Punica granatum] Length = 86 Score = 70.1 bits (170), Expect = 6e-13 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 1 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 96 DPLVPEIAHMYKTDRAKYE+TARSWTQKYAMG Sbjct: 55 DPLVPEIAHMYKTDRAKYEATARSWTQKYAMG 86 >ref|XP_022770534.1| ubiquitin-conjugating enzyme E2 28-like isoform X2 [Durio zibethinus] Length = 128 Score = 71.2 bits (173), Expect = 6e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 1 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 96 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG Sbjct: 97 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 128 >ref|XP_016692914.1| PREDICTED: ubiquitin-conjugating enzyme E2 28-like isoform X2 [Gossypium hirsutum] ref|XP_016692915.1| PREDICTED: ubiquitin-conjugating enzyme E2 28-like isoform X2 [Gossypium hirsutum] Length = 128 Score = 71.2 bits (173), Expect = 6e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 1 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 96 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG Sbjct: 97 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 128 >gb|POE79129.1| ubiquitin-conjugating enzyme e2-17 kda [Quercus suber] Length = 92 Score = 70.1 bits (170), Expect = 7e-13 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 1 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 96 DPLVPEIAHMYKTDRAKYE+TARSWTQKYAMG Sbjct: 61 DPLVPEIAHMYKTDRAKYETTARSWTQKYAMG 92 >ref|XP_020276641.1| ubiquitin-conjugating enzyme E2-17 kDa-like isoform X2 [Asparagus officinalis] Length = 134 Score = 71.2 bits (173), Expect = 7e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 1 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 96 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG Sbjct: 103 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 134 >gb|ONM12406.1| Ubiquitin-conjugating enzyme E2 11 [Zea mays] Length = 142 Score = 71.2 bits (173), Expect = 9e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 1 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 96 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG Sbjct: 111 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 142 >gb|KDO64145.1| hypothetical protein CISIN_1g0337002mg, partial [Citrus sinensis] gb|KDO64146.1| hypothetical protein CISIN_1g0337002mg, partial [Citrus sinensis] gb|KDO64147.1| hypothetical protein CISIN_1g0337002mg, partial [Citrus sinensis] gb|KDO64148.1| hypothetical protein CISIN_1g0337002mg, partial [Citrus sinensis] Length = 47 Score = 68.6 bits (166), Expect = 9e-13 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +1 Query: 1 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 96 DPLVPEIAHMYK+D+AKYESTARSWTQKYAMG Sbjct: 16 DPLVPEIAHMYKSDKAKYESTARSWTQKYAMG 47 >ref|XP_019701380.1| PREDICTED: ubiquitin-conjugating enzyme E2 28-like [Elaeis guineensis] Length = 146 Score = 71.2 bits (173), Expect = 1e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 1 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 96 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG Sbjct: 115 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 146 >gb|AAF24583.1|AC007764_25 F22C12.2 [Arabidopsis thaliana] Length = 146 Score = 71.2 bits (173), Expect = 1e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 1 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 96 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG Sbjct: 115 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 146 >gb|PPR85610.1| hypothetical protein GOBAR_AA35082 [Gossypium barbadense] Length = 147 Score = 71.2 bits (173), Expect = 1e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 1 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 96 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG Sbjct: 116 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 147 >gb|PON47206.1| Ubiquitin-fold modifier-conjugating enzyme [Parasponia andersonii] gb|POO02911.1| Ubiquitin-fold modifier-conjugating enzyme [Trema orientalis] Length = 148 Score = 71.2 bits (173), Expect = 1e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 1 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 96 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG Sbjct: 117 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 148 >gb|PKA64238.1| Ubiquitin-conjugating enzyme E2 28 [Apostasia shenzhenica] Length = 148 Score = 71.2 bits (173), Expect = 1e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 1 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 96 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG Sbjct: 117 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 148 >ref|XP_022770533.1| ubiquitin-conjugating enzyme E2 28-like isoform X1 [Durio zibethinus] Length = 148 Score = 71.2 bits (173), Expect = 1e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 1 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 96 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG Sbjct: 117 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 148 >ref|XP_022757501.1| ubiquitin-conjugating enzyme E2 28 [Durio zibethinus] Length = 148 Score = 71.2 bits (173), Expect = 1e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 1 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 96 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG Sbjct: 117 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 148 >gb|OVA08260.1| Ubiquitin-conjugating enzyme [Macleaya cordata] Length = 148 Score = 71.2 bits (173), Expect = 1e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 1 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 96 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG Sbjct: 117 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 148