BLASTX nr result
ID: Ophiopogon27_contig00001406
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00001406 (419 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020247799.1| protein MULTIPLE CHLOROPLAST DIVISION SITE 1... 65 9e-10 >ref|XP_020247799.1| protein MULTIPLE CHLOROPLAST DIVISION SITE 1 [Asparagus officinalis] Length = 333 Score = 65.5 bits (158), Expect = 9e-10 Identities = 34/58 (58%), Positives = 42/58 (72%) Frame = -3 Query: 417 INLRSIQGSEGAVGPSSIPREQTEPIPSTNQQYNHMTTNANSEAGSNESMLEDEMKTK 244 IN+RSIQGSEGAV S + Q +P ST+QQY HM +N N+E GS E++L DEMK K Sbjct: 276 INVRSIQGSEGAVS-SQKSKPQEQPSSSTDQQYKHMPSNPNTEDGSGENLLPDEMKRK 332