BLASTX nr result
ID: Ophiopogon27_contig00001004
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00001004 (458 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020247436.1| uncharacterized protein LOC109825113 [Aspara... 61 4e-08 >ref|XP_020247436.1| uncharacterized protein LOC109825113 [Asparagus officinalis] gb|ONK56675.1| uncharacterized protein A4U43_C10F11500 [Asparagus officinalis] Length = 251 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -3 Query: 456 KWSITDLGPWPFSYGLGSNLCDSACKGCSERY 361 KWS DL PWP SY LGS+LCD+ACKGC ERY Sbjct: 194 KWSTIDLRPWPISYSLGSSLCDAACKGCCERY 225