BLASTX nr result
ID: Ophiopogon26_contig00055970
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00055970 (481 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_084498289.1| fasciclin domain-containing protein [Pedobac... 54 9e-06 >ref|WP_084498289.1| fasciclin domain-containing protein [Pedobacter sp. V48] gb|ETZ22488.1| hypothetical protein N824_23800 [Pedobacter sp. V48] Length = 197 Score = 53.9 bits (128), Expect = 9e-06 Identities = 25/53 (47%), Positives = 36/53 (67%) Frame = +2 Query: 11 SADFAPFQKLFTAEGDKLKITAGNSCWMVDDAKILVPDVQAKNGVIFLIDRVL 169 S+D +L T +G K+K+T N W V+DAKI++PDV + NGV ++ID VL Sbjct: 141 SSDLKNGMELATVQGQKIKLTEKNGEWWVNDAKIIIPDVISSNGVTYVIDGVL 193