BLASTX nr result
ID: Ophiopogon26_contig00055929
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00055929 (480 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACT52854.1| mitochondrial DNA, partial [Polyporus grammocepha... 56 8e-07 >gb|ACT52854.1| mitochondrial DNA, partial [Polyporus grammocephalus] Length = 167 Score = 56.2 bits (134), Expect = 8e-07 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +1 Query: 286 LLIGWSDFTHHYFRSLG*FTFLSLLQCFGSGSSYIK 393 L +G+SDFT HYFRSLG F FLSL++CF SGSS IK Sbjct: 98 LFLGYSDFTRHYFRSLGSFPFLSLMKCFTSGSSDIK 133