BLASTX nr result
ID: Ophiopogon26_contig00055927
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00055927 (371 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020276392.1| uncharacterized protein LOC109850736 [Aspara... 72 3e-12 gb|ONK64926.1| uncharacterized protein A4U43_C07F31540 [Asparagu... 68 1e-10 ref|XP_010935066.1| PREDICTED: uncharacterized protein LOC105055... 59 1e-07 >ref|XP_020276392.1| uncharacterized protein LOC109850736 [Asparagus officinalis] Length = 477 Score = 72.4 bits (176), Expect = 3e-12 Identities = 32/55 (58%), Positives = 42/55 (76%) Frame = +2 Query: 206 PFTSPSHEMGSTSITQRDIPEKNLQNVLTARLRSFFDPGELPNTRVWPGMEFGWR 370 P TS + E S+ + +I ++NL+N+LT+RLRSFFDPGE +TRVWP MEFGWR Sbjct: 24 PLTSSALETFSSITAREEIADENLRNILTSRLRSFFDPGESASTRVWPDMEFGWR 78 >gb|ONK64926.1| uncharacterized protein A4U43_C07F31540 [Asparagus officinalis] Length = 521 Score = 67.8 bits (164), Expect = 1e-10 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 1/44 (2%) Frame = +2 Query: 242 SITQRD-IPEKNLQNVLTARLRSFFDPGELPNTRVWPGMEFGWR 370 SIT R+ I ++NL+N+LT+RLRSFFDPGE +TRVWP MEFGWR Sbjct: 79 SITAREEIADENLRNILTSRLRSFFDPGESASTRVWPDMEFGWR 122 >ref|XP_010935066.1| PREDICTED: uncharacterized protein LOC105055061 [Elaeis guineensis] Length = 495 Score = 58.9 bits (141), Expect = 1e-07 Identities = 29/59 (49%), Positives = 37/59 (62%), Gaps = 2/59 (3%) Frame = +2 Query: 200 NRPFTSPSHEMGSTSIT--QRDIPEKNLQNVLTARLRSFFDPGELPNTRVWPGMEFGWR 370 NRP S +HEMGS+SI+ I EK+ + +L+ S FD G+ T VWP MEFGWR Sbjct: 31 NRPLASSAHEMGSSSISTNHNKIMEKDYKYILSNIFHSLFDNGDSSYTHVWPDMEFGWR 89