BLASTX nr result
ID: Ophiopogon26_contig00055908
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00055908 (493 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ELU37841.1| hypothetical protein AG1IA_08127 [Rhizoctonia sol... 61 1e-17 >gb|ELU37841.1| hypothetical protein AG1IA_08127 [Rhizoctonia solani AG-1 IA] Length = 139 Score = 61.2 bits (147), Expect(2) = 1e-17 Identities = 33/54 (61%), Positives = 39/54 (72%) Frame = +1 Query: 139 YIQAMVRFYADYRIKQHASLRLLRGRLIFFVFTFASILTRRNG*RVHIGTNFKI 300 YIQAMVRFYADYRIKQHASLRLLRGRLIF F+ + G V++ T+ + Sbjct: 5 YIQAMVRFYADYRIKQHASLRLLRGRLIFL---FSLLQVYSQGGMVNVFTSLGV 55 Score = 56.2 bits (134), Expect(2) = 1e-17 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 369 TFVSQRQSLNGKSLSLLVFPLIFTDLILSL 458 TFVSQRQSLNGKS SLLVFPLIFTDLILSL Sbjct: 66 TFVSQRQSLNGKSPSLLVFPLIFTDLILSL 95