BLASTX nr result
ID: Ophiopogon26_contig00055825
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00055825 (465 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC70370.1| hypothetical protein RhiirA1_532755 [Rhizophagus ... 60 5e-09 >gb|PKC70370.1| hypothetical protein RhiirA1_532755 [Rhizophagus irregularis] gb|PKY28562.1| hypothetical protein RhiirB3_529945 [Rhizophagus irregularis] Length = 101 Score = 60.5 bits (145), Expect = 5e-09 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 170 MRWMNERMNDLNGRNEQYKLENERHDTI*M 81 MRWMNERMNDLNGRNEQYKLENERH+ + M Sbjct: 12 MRWMNERMNDLNGRNEQYKLENERHEWVNM 41